Active GMP Recombinant Human PDGF-AA Protein
| Cat.No. : | PDGF-AA-01HG |
| Product Overview : | Active GMP Recombinant Human PDGF-AA Protein(P04085)(87-211 aa) was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Non |
| Protein Length : | 87-211 aa |
| Form : | PBS,5% mannitol and 0.01% Tween 80, pH7.4 |
| Bio-activity : | The Bioactivity is determined by the dose-dependent proliferation of NIH3T3 cells is typically between ≤5.0 ng/mL. |
| Molecular Mass : | 14.3kDa |
| AASequence : | IEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
| Endotoxin : | ≤10 EU/mg by the LAL method |
| Purity : | ≥95%, by SDS-PAGE (under reducing (R) & Non-reducing conditions, visualized by Coomassie staining) |
| Storage : | 36 months at -20°C to -80°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended to redissolve in sterile deionized water. |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PDGF-AA Products
Required fields are marked with *
My Review for All PDGF-AA Products
Required fields are marked with *
