Active GMP Recombinant Human PDGF-AA Protein

• Cat.No.: PDGF-AA-01HG
• Product Overview: Active GMP Recombinant Human PDGF-AA Protein(P04085)(87-211 aa) was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 87-211 aa
• Form: PBS,5% mannitol and 0.01% Tween 80, pH7.4
• Bio-activity: The Bioactivity is determined by the dose-dependent proliferation of NIH3T3 cells is typically between ≤5.0 ng/mL.
• Molecular Mass: 14.3kDa
• AASequence: IEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
• Endotoxin: ≤10 EU/mg by the LAL method
• Purity: ≥95%, by SDS-PAGE (under reducing (R) & Non-reducing conditions, visualized by Coomassie staining)
• Storage: 36 months at -20°C to -80°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended to redissolve in sterile deionized water.