Active GMP Recombinant Porcine TNF-α Protein, His-Tagged

Cat.No. : TNF-α-01P
Product Overview : GMP Recombinant Porcine TNF-α Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : TNF-α is a kind of pleiotropic pro-inflammatory cytokine. It is secreted by various cells, such as adipocytes, activated monocytes, macrophages, B cells, T cells and fibroblasts. Proteolysis of the integral membrane precursor form of TNF-α from cells soluble can release homotrimeric TNF-α. TNF-α can bind with some TNF-α receptors induces apoptosis, besides, also trigger other responses depending on cell type, receptor expression, and signal transduction status. TNF-α participate in the inflammatory response.
Form : Lyophilized
Bio-activity : Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is <15 pg/mL.
AA Sequence : MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNF-α Products

Required fields are marked with *

My Review for All TNF-α Products

Required fields are marked with *

0
cart-icon
0
compare icon