Active GMP Recombinant Porcine TNF-α Protein, His-Tagged
| Cat.No. : | TNF-α-01P |
| Product Overview : | GMP Recombinant Porcine TNF-α Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Porcine |
| Source : | E.coli |
| Tag : | His |
| Description : | TNF-α is a kind of pleiotropic pro-inflammatory cytokine. It is secreted by various cells, such as adipocytes, activated monocytes, macrophages, B cells, T cells and fibroblasts. Proteolysis of the integral membrane precursor form of TNF-α from cells soluble can release homotrimeric TNF-α. TNF-α can bind with some TNF-α receptors induces apoptosis, besides, also trigger other responses depending on cell type, receptor expression, and signal transduction status. TNF-α participate in the inflammatory response. |
| Form : | Lyophilized |
| Bio-activity : | Measure by its ability to induce cytotoxicity in PK15 cells in the presence of the actinomycin D. The ED50 for this effect is <15 pg/mL. |
| AA Sequence : | MLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : | Please use within one month after protein reconstitution. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNF-α Products
Required fields are marked with *
My Review for All TNF-α Products
Required fields are marked with *
