Active Recombinant Full Length Human NCL Protein, C-Flag-tagged
Cat.No. : | NCL-03HFL |
Product Overview : | Recombinant Full Length Human NCL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Nucleolin (NCL), a eukaryotic nucleolar phosphoprotein, is involved in the synthesis and maturation of ribosomes. It is located mainly in dense fibrillar regions of the nucleolus. Human NCL gene consists of 14 exons with 13 introns and spans approximately 11kb. The intron 11 of the NCL gene encodes a small nucleolar RNA, termed U20. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | EMSA reaction positive control Taq polymerase assay (regulator) Binding assay (Dimethylsulfate footprinting) Binding assay (FRET) Surface Plasmon Ressonance (SPR) Association in cell culture Surface Plasmon Ressonance (SPR) EMSA reaction positive control ELISA binding assay |
Molecular Mass : | 76.4 kDa |
AA Sequence : | MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTK KVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNA KKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEA METTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKR KKEMAKQKAAPEAKKQKVEGTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFG YVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSGESKTLVL SNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEALNSCNKREIEGRAIRLELQGP RGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAM EDGEIDGNKVTLDWAKPKGEGGFGGRGGGRGGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDH KPQGKKTKFETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Pathogenic Escherichia coli infection |
Full Length : | Full L. |
Gene Name | NCL nucleolin [ Homo sapiens (human) ] |
Official Symbol | NCL |
Synonyms | C23; Nsr1 |
Gene ID | 4691 |
mRNA Refseq | NM_005381.3 |
Protein Refseq | NP_005372.2 |
MIM | 164035 |
UniProt ID | P19338 |
◆ Recombinant Proteins | ||
NCL-6817C | Recombinant Chicken NCL | +Inquiry |
NCL-1022H | Recombinant Human NCL protein, mFc-tagged | +Inquiry |
NCL-10477M | Recombinant Mouse NCL Protein | +Inquiry |
NCL-5944M | Recombinant Mouse NCL Protein, His (Fc)-Avi-tagged | +Inquiry |
NCL-728C | Recombinant Cynomolgus NCL Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
NCL-01H | Recombinant Human Nucleolin-GFP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCL-1174HCL | Recombinant Human NCL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCL Products
Required fields are marked with *
My Review for All NCL Products
Required fields are marked with *
0
Inquiry Basket