Active Recombinant Human BRS3 Protein, GST-tagged

Cat.No. : BRS3-347H
Product Overview : Human BRS3 partial ORF ( NP_001718, 290 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Mammalian bombesin-like peptides (see MIM 137260) are widely distributed in the central nervous system as well as in the gastrointestinal tract, where they modulate smooth-muscle contraction, exocrine and endocrine processes, metabolism, and behavior. They bind to G protein-coupled receptors on the cell surface to elicit their effects. Bombesin-like peptide receptors include gastrin-releasing peptide receptor (MIM 305670), neuromedin B receptor (MIM 162341), and bombesin-like receptor-3 (BRS3) (Ohki-Hamazaki et al., 1997).
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Bio-activity : The activity was measured by off-chip mobility shift assay. The enzyme was incubated with fluorescence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by LabChip 3000. Substrate: CHKtide. ATP: 100 uM.
Molecular Mass : 37.84 kDa
AA Sequence : LYLYHSFTSQTYVDPSAMHFIFTIFSRVLAFSNSCVNPFALYWLSKSFQKHFKAQLFCCKAERPEPPVADTSLTTLAVMGTVPGTGSIQMSEISVTSFTGCSVKQAEDRF
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BRS3 bombesin-like receptor 3 [ Homo sapiens ]
Official Symbol BRS3
Synonyms BRS3; bombesin-like receptor 3; bombesin receptor subtype-3; BRS-3; G-protein coupled receptor; bombesin receptor subtype 3;
Gene ID 680
mRNA Refseq NM_001727
Protein Refseq NP_001718
MIM 300107
UniProt ID P32247

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BRS3 Products

Required fields are marked with *

My Review for All BRS3 Products

Required fields are marked with *

0
cart-icon