Active Recombinant Human Peptidylprolyl Isomerase G, His-tagged
Cat.No. : | PPIG-1102H |
Product Overview : | Human PPIG (AAH01555, 1 a.a. ~ 175 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human |
Tag : | His |
Description : | The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. |
Sequence : | MGSSHHHHHHSSGLVPRGSHMGIKVQRPRC- FFDIAINNQPAGRVVFELFSDVCPKTCENFRC LCTGEKGTGKSTQKPLHYKSCLFHRVVKDFM VQGGDFSEGNGRGGESIYGGFFEDESFAVKH NKEFLLSMANRGKDTNGSQFFITTKPTPHLDG HHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCG |
Theoretical MW (kDa) : | 21.6 |
Form : | Liquid |
Preparation Method : | Escherichia coli expression system |
Purity : | μ 95% by SDS-PAGE |
Activity : | Specific activity is > 75 nmoles/min/ug, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 1 °C in Tris-HCl pH 8.0 using chymotrypsin. |
Application : | SDS-PAGE; Functional Study |
Storage Buffer : | In 20 mM Tris, pH 7.5 (1 mM dithiothreitol, 10% glycerol). |
Storage : | Store at 4°C for 1~2 weeks. For long term storage store at -20°C or -80°C.Aliquot to avoid repeated freezing and thawing. |
Unitprot ID : | Q13427 |
Functions : | cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity |
Gene Name | PPIG peptidylprolyl isomerase G (cyclophilin G) [ Homo sapiens ] |
Official Symbol | PPIG |
Synonyms | PPIG; peptidylprolyl isomerase G (cyclophilin G); CYP; SRCyp; CARS-Cyp; MGC133241; peptidylprolyl isomerase G; Clk-associating RS-cyclophilin; peptidyl-prolyl isomerase G (cyclophilin G); EC 5.2.1.8; CARS-cyclophilin; CASP10; SR-cyclophilin; SR-cyclophilin; SR-cyp; Cyclophilin G; PPIase G; Peptidyl-prolyl isomerase G; Peptidyl-prolyl cis-trans isomerase G; Rotamase G |
Gene ID | 9360 |
mRNA Refseq | NM_004792 |
Protein Refseq | NP_004783 |
MIM | 606093 |
Chromosome Location | 2q31.1 |
◆ Recombinant Proteins | ||
PPIG-28674TH | Recombinant Human PPIG, His-tagged | +Inquiry |
PPIG-12632Z | Recombinant Zebrafish PPIG | +Inquiry |
PPIG-4604R | Recombinant Rat PPIG Protein | +Inquiry |
PPIG-1102H | Active Recombinant Human Peptidylprolyl Isomerase G, His-tagged | +Inquiry |
PPIG-3366R | Recombinant Rhesus Macaque PPIG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPIG-1396HCL | Recombinant Human PPIG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPIG Products
Required fields are marked with *
My Review for All PPIG Products
Required fields are marked with *
0
Inquiry Basket