Active Recombinant Human Peptidylprolyl Isomerase G, His-tagged

Cat.No. : PPIG-1102H
Product Overview : Human PPIG (AAH01555, 1 a.a. ~ 175 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human
Tag : His
Description : The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death.
Sequence : MGSSHHHHHHSSGLVPRGSHMGIKVQRPRC- FFDIAINNQPAGRVVFELFSDVCPKTCENFRC LCTGEKGTGKSTQKPLHYKSCLFHRVVKDFM VQGGDFSEGNGRGGESIYGGFFEDESFAVKH NKEFLLSMANRGKDTNGSQFFITTKPTPHLDG HHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCG
Theoretical MW (kDa) : 21.6
Form : Liquid
Preparation Method : Escherichia coli expression system
Purity : μ 95% by SDS-PAGE
Activity : Specific activity is > 75 nmoles/min/ug, and is defined as the amount of enzyme that cleaves 1umole of suc-AAFP-pNA per minute at 1 °C in Tris-HCl pH 8.0 using chymotrypsin.
Application : SDS-PAGE; Functional Study
Storage Buffer : In 20 mM Tris, pH 7.5 (1 mM dithiothreitol, 10% glycerol).
Storage : Store at 4°C for 1~2 weeks. For long term storage store at -20°C or -80°C.Aliquot to avoid repeated freezing and thawing.
Unitprot ID : Q13427
Functions : cyclosporin A binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity
Gene Name PPIG peptidylprolyl isomerase G (cyclophilin G) [ Homo sapiens ]
Official Symbol PPIG
Synonyms PPIG; peptidylprolyl isomerase G (cyclophilin G); CYP; SRCyp; CARS-Cyp; MGC133241; peptidylprolyl isomerase G; Clk-associating RS-cyclophilin; peptidyl-prolyl isomerase G (cyclophilin G); EC 5.2.1.8; CARS-cyclophilin; CASP10; SR-cyclophilin; SR-cyclophilin; SR-cyp; Cyclophilin G; PPIase G; Peptidyl-prolyl isomerase G; Peptidyl-prolyl cis-trans isomerase G; Rotamase G
Gene ID 9360
mRNA Refseq NM_004792
Protein Refseq NP_004783
MIM 606093
Chromosome Location 2q31.1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPIG Products

Required fields are marked with *

My Review for All PPIG Products

Required fields are marked with *

0
cart-icon
0
compare icon