Active Recombinant Human ST3GAL4 Protein (AA 34-329), N-6×His/GFP tagged
| Cat.No. : | ST3GAL4-13H |
| Product Overview : | Recombinant Human ST3GAL4 Protein (AA 34-329) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 34-329 |
| Description : | This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Bio-activity : | ≥0.23 μmol/min/mg |
| Molecular Mass : | ~60-70 kDa |
| AA Sequence : | EKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF |
| Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
| Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
| Preservative : | 0.05 % NaN3 |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [ Homo sapiens (human) ] |
| Official Symbol | ST3GAL4 |
| Synonyms | ST3GAL4; ST3 beta-galactoside alpha-2,3-sialyltransferase 4; CGS23, NANTA3, sialyltransferase 4C (beta galactosidase alpha 2,3 sialytransferase) , SIAT4, SIAT4C; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; FLJ11867; SAT3; ST3Gal IV; STZ; ST-4; SAT-3; SIAT4-C; ST3GalA.2; gal-NAc6S; alpha 2,3-ST 4; alpha 2,3-sialyltransferase IV; alpha-3-N-acetylneuraminyltransferase; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase); sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase); CGS23; SIAT4; NANTA3; SIAT4C; ST3GalIV; FLJ46764; |
| Gene ID | 6484 |
| mRNA Refseq | NM_006278 |
| Protein Refseq | NP_006269 |
| MIM | 104240 |
| UniProt ID | Q11206 |
| ◆ Recombinant Proteins | ||
| ST3GAL4-4499R | Recombinant Rhesus monkey ST3GAL4 Protein, His-tagged | +Inquiry |
| ST3GAL4-8761M | Recombinant Mouse ST3GAL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ST3GAL4-4315R | Recombinant Rhesus Macaque ST3GAL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ST3GAL4-16065M | Recombinant Mouse ST3GAL4 Protein | +Inquiry |
| ST3GAL4-5349Z | Recombinant Zebrafish ST3GAL4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST3GAL4-633HCL | Recombinant Human ST3GAL4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST3GAL4 Products
Required fields are marked with *
My Review for All ST3GAL4 Products
Required fields are marked with *



