Active Recombinant Human ST3GAL4 Protein (AA 34-329), N-6×His/GFP tagged

Cat.No. : ST3GAL4-13H
Product Overview : Recombinant Human ST3GAL4 Protein (AA 34-329) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 34-329
Description : This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene.
Bio-activity : ≥0.23 μmol/min/mg
Molecular Mass : ~60-70 kDa
AA Sequence : EKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
Purity : >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name ST3GAL4 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [ Homo sapiens (human) ]
Official Symbol ST3GAL4
Synonyms ST3GAL4; ST3 beta-galactoside alpha-2,3-sialyltransferase 4; CGS23, NANTA3, sialyltransferase 4C (beta galactosidase alpha 2,3 sialytransferase) , SIAT4, SIAT4C; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; FLJ11867; SAT3; ST3Gal IV; STZ; ST-4; SAT-3; SIAT4-C; ST3GalA.2; gal-NAc6S; alpha 2,3-ST 4; alpha 2,3-sialyltransferase IV; alpha-3-N-acetylneuraminyltransferase; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase); sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase); CGS23; SIAT4; NANTA3; SIAT4C; ST3GalIV; FLJ46764;
Gene ID 6484
mRNA Refseq NM_006278
Protein Refseq NP_006269
MIM 104240
UniProt ID Q11206

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ST3GAL4 Products

Required fields are marked with *

My Review for All ST3GAL4 Products

Required fields are marked with *

0
cart-icon