Active Recombinant Mouse Cxcl1 Protein
Cat.No. : | Cxcl1-271C |
Product Overview : | Recombinant Mouse Cxcl1 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Growth-regulated Alpha Protein (GRO), also known as CXCL-1, GRO1, MGSA and SCYB1, is a chemokine belonging to the intercrine alpha (Chemokine CXC) family. It is expressed mainly by macrophages, neutrophils and epithelial cells. GRO signals through chemokine receptor CXCR1 and CXCR2, and functions to chemoattract and activate neutrophils and basophils. It is also a hematoregulatory chemokine, which suppresses hematopoietic progenitor cell proliferation. GRO has also been reported to play a role in spinal cord development, angiogenesis, wound healing and tumorigenesis. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Active at 10 ng/mL, measured in a tube formation assay using HUVEC cells. |
Molecular Mass : | 5-7 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Mouse GRO remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse GRO should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Cxcl1 chemokine (C-X-C motif) ligand 1 [ Mus musculus ] |
Official Symbol | Cxcl1 |
Synonyms | CXCL1; chemokine (C-X-C motif) ligand 1; growth-regulated alpha protein; KC/GR)-alpha; KC/GRO-alpha; GRO1 oncogene; secretory protein N51; C-X-C motif chemokine 1; platelet-derived growth factor-inducible protein KC; KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1; |
Gene ID | 14825 |
mRNA Refseq | NM_008176 |
Protein Refseq | NP_032202 |
UniProt ID | P12850 |
◆ Recombinant Proteins | ||
CXCL1-13H | Recombinant Human CXCL1 Protein, Biotin-tagged | +Inquiry |
CXCL1-001H | Recombinant Human CXCL1 Protein, MBP-tagged | +Inquiry |
Cxcl1-96M | Recombinant Mouse Cxcl1 protein | +Inquiry |
CXCL1-2370H | Recombinant Human CXCL1 protein(Ala35-Asn107) | +Inquiry |
CXCL1-244H | Active Recombinant Human Chemokine (C-X-C Motif) Ligand 1, HIgG1 Fc-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL1-27707TH | Native Human CXCL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL1-425HCL | Recombinant Human CXCL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl1 Products
Required fields are marked with *
My Review for All Cxcl1 Products
Required fields are marked with *
0
Inquiry Basket