Active Recombinant Mouse Fgf2 Protein

Cat.No. : Fgf2-061M
Product Overview : Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Broad expression in mammary gland adult (RPKM 4.1), ovary adult (RPKM 3.7) and 18 other tissues.
Bio-activity : Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 10^6 units/mg.
Molecular Mass : 15.9 kDa
AA Sequence : PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Fgf2 fibroblast growth factor 2 [ Mus musculus (house mouse) ]
Official Symbol Fgf2
Synonyms Fgf2; fibroblast growth factor 2; Fgfb; bFGF; Fgf-2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2
Gene ID 14173
mRNA Refseq NM_008006
Protein Refseq NP_032032
UniProt ID P15655

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf2 Products

Required fields are marked with *

My Review for All Fgf2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon