Active Recombinant Mouse Fgf2 Protein
Cat.No. : | Fgf2-061M |
Product Overview : | Purified recombinant protein of Mouse fibroblast growth factor 2 (Fgf2) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Broad expression in mammary gland adult (RPKM 4.1), ovary adult (RPKM 3.7) and 18 other tissues. |
Bio-activity : | Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 10^6 units/mg. |
Molecular Mass : | 15.9 kDa |
AA Sequence : | PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Fgf2 fibroblast growth factor 2 [ Mus musculus (house mouse) ] |
Official Symbol | Fgf2 |
Synonyms | Fgf2; fibroblast growth factor 2; Fgfb; bFGF; Fgf-2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2 |
Gene ID | 14173 |
mRNA Refseq | NM_008006 |
Protein Refseq | NP_032032 |
UniProt ID | P15655 |
◆ Recombinant Proteins | ||
Fgf2-5419M | Recombinant Mouse Fgf2 Protein (Met1-Ser154) | +Inquiry |
FGF2-022H | Active Recombinant Human FGF2 Protein | +Inquiry |
FGF2-27258TH | Recombinant Human FGF2, His-tagged | +Inquiry |
FGF2-133H | Recombinant Human FGF2 Protein | +Inquiry |
FGF2-401F | Active Recombinant Human FGF2 Protein (146 aa) | +Inquiry |
◆ Native Proteins | ||
FGF2-34B | Active Native Bovine bFGF | +Inquiry |
FGF2-26551TH | Native Human FGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf2 Products
Required fields are marked with *
My Review for All Fgf2 Products
Required fields are marked with *
0
Inquiry Basket