Active Recombinant Mouse Fgf2 Protein (146 aa)
| Cat.No. : | Fgf2-398F |
| Product Overview : | Recombinant mouse Fibroblast Growth Factor-basic (rmFGF-basic) produced in E. coli is a single non-glycosylated polypeptide chain containing 146 amino acids. A fully biologically active molecule, rmFGF-basic has a molecular mass of 16.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 146 |
| Description : | Fibroblast Growth Factor-basic (FGF-basic), also known as HBGF-2, is a non-glycosylated heparin-binding growth factor that belongs to the FGF family. FGF-basic is present in basement membranes and in the subendothelial extracellular matrix of blood vessels. FGF-basic signals through FGFR1, 2, 3 and 4 that plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 0.5 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 2.0 × 10^6 units/mg. |
| Molecular Mass : | 16.4 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% by SDS-PAGE and HPLC analyses. |
| Storage : | Lyophilized recombinant mouse Fibroblast Growth Factor-basic (rmFGF-basic) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmFGF-basic should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
| Gene Name | Fgf2 fibroblast growth factor 2 [ Mus musculus ] |
| Official Symbol | Fgf2 |
| Synonyms | FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; Fgfb; bFGF; Fgf-2; |
| Gene ID | 14173 |
| mRNA Refseq | NM_008006 |
| Protein Refseq | NP_032032 |
| UniProt ID | P15655 |
| ◆ Recombinant Proteins | ||
| FGF2-19H | Active Recombinant Human FGF2 protein, ERHV-His-tagged | +Inquiry |
| FGF2-12B | Recombinant Bovine FGF2 Protein | +Inquiry |
| Fgf2-829M | Active Recombinant Mouse Fgf2 protein(Ala11-Ser154), His-tagged | +Inquiry |
| Fgf2-398F | Active Recombinant Mouse Fgf2 Protein (146 aa) | +Inquiry |
| FGF2-6983C | Recombinant Chicken FGF2 | +Inquiry |
| ◆ Native Proteins | ||
| FGF2-26551TH | Native Human FGF2 | +Inquiry |
| FGF2-34B | Active Native Bovine bFGF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fgf2 Products
Required fields are marked with *
My Review for All Fgf2 Products
Required fields are marked with *



