Recombinant Duck FGF Basic Protein, Tag Free
| Cat.No. : | FGF2-066D |
| Product Overview : | The Mallard FGF Basic yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Duck |
| Source : | Yeast |
| Tag : | Non |
| Description : | Fibroblast growth factors, or FGFs, are a family of growth factors involved in angiogenesis, wound healing, and embryonic development. The FGF family members are heparin-binding proteins and interactions with cell-surface-associated heparan sulfate proteoglycans have been shown to be essential for FGF signal transduction. There are currently 24 members of the FGF family. FGF basic (FGF2)and FGF acidic (FGF1) are multipotential factors that stimulate and support proliferation, migration and differentiation. |
| AASequence : | PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS |
| Molecular Mass : | 16.3 kDa |
| Endotoxin : | Naturally endotoxin-free |
| Purity : | Greater than 98% as visualized by SDS-PAGE analysis. |
| Application : | Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control |
| Note : | For research use only. |
| Storage : | Store at -20 centigrade. |
| Gene Name | FGF2 fibroblast growth factor 2 [ Anas platyrhynchos (mallard) ] |
| Official Symbol | FGF2 |
| Synonyms | FGF2; fibroblast growth factor 2; fibroblast growth factor 2; Heparin-binding growth factor 2 |
| Gene ID | 101798064 |
| mRNA Refseq | XM_027456828 |
| Protein Refseq | XP_027312629 |
| UniProt ID | A0A8B9QXP1 |
| ◆ Recombinant Proteins | ||
| FGF2-022H | Active Recombinant Human FGF2 Protein | +Inquiry |
| FGF2-19H | Active Recombinant Human FGF2 protein, ERHV-His-tagged | +Inquiry |
| FGF2-17H | Active Recombinant Human FGF2 Protein (Formulation II-Carrier-Ready-to-Use, 134-288, 154 amino acid) | +Inquiry |
| FGF2-5403H | Recombinant Human FGF2 protein, His-tagged | +Inquiry |
| FGF2-169H | Active Recombinant Human FGF2 | +Inquiry |
| ◆ Native Proteins | ||
| FGF2-34B | Active Native Bovine bFGF | +Inquiry |
| FGF2-26551TH | Native Human FGF2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF2-638HCL | Recombinant Human FGF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF2 Products
Required fields are marked with *
My Review for All FGF2 Products
Required fields are marked with *
