Recombinant Chicken FGF Basic Protein, Tag Free

Cat.No. : FGF2-065C
Product Overview : The Chicken FGF Basic yeast-derived recombinant protein is not tagged and is naturally endotoxin-free.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Chicken
Source : Yeast
Tag : Non
Description : Fibroblast growth factors, or FGFs, are a family of growth factors involved in angiogenesis, wound healing, and embryonic development. The FGF family members are heparin-binding proteins and interactions with cell-surface-associated heparan sulfate proteoglycans have been shown to be essential for FGF signal transduction. There are currently 24 members of the FGF family. FGF basic (FGF2)and FGF acidic (FGF1) are multipotential factors that stimulate and support proliferation, migration and differentiation.
AASequence : PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS
Molecular Mass : 16.3 kDa
Endotoxin : Naturally endotoxin-free
Purity : Greater than 98% as visualized by SDS-PAGE analysis.
Application : Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Note : For research use only.
Storage : Store at -20 centigrade.
Gene Name FGF2 fibroblast growth factor 2 [ Gallus gallus (chicken) ]
Official Symbol FGF2
Synonyms FGF2; fibroblast growth factor 2; BFGF; FGF-2; HBGF-2; fibroblast growth factor 2; basic fibroblast growth factor; fibroblast growth factor 2 (basic); heparin-binding growth factor 2
Gene ID 396413
mRNA Refseq NM_205433
Protein Refseq NP_990764
UniProt ID P48800

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF2 Products

Required fields are marked with *

My Review for All FGF2 Products

Required fields are marked with *

0
cart-icon
0
compare icon