Recombinant Cynomolgus Monkey IL21 Protein

Cat.No. : IL21-24C
Product Overview : Recombinant Cynomolgus Monkey IL21 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Cynomolgus
Source : E.coli
Description : This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Form : Liquid. In 1xPBS, pH 7.4.
Molecular Mass : ~18.6 kDa
AA Sequence : MGWSCIILFLVATATGVHSHHHHHHGGGGSQGQDRHMIRMRQLIDIVDQLKNYVNDLDPEFLPAPEDVETNCEWSAISCFQKAQLKSANTGNNERIINLSIKKLKRKSPSTGAERRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Purity : >90%
Storage : Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.75 mg/ml
Official Full Name : Interleukin 21
Gene Name IL21 interleukin 21 [ Macaca fascicularis (crab-eating macaque) ]
Official Symbol IL21
Synonyms Za11; IL-21; CVID11
Gene ID 102130762
mRNA Refseq XM_005555864
Protein Refseq XP_005555921
UniProt ID A0A2K5VG93

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL21 Products

Required fields are marked with *

My Review for All IL21 Products

Required fields are marked with *

0
cart-icon