Species : |
Rat |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
129 |
Description : |
Rat IL-21 is produced by CD4+ T cells in response to antigenic stimulation and can regulating immune system cells, for instance cytotoxin T cells and natural killer cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells, stimulation with IL-4 of IgG production, and induction of apoptotic effects in naïve B-cells and stimulated B-cells in the absence of T-cell signaling. Additionally, it promotes the anti-tumor activity of CD8+ T-cells and NK cells. IL-21 elicits its effect through binding to IL-21R, which also contains the gamma chain found in other cytokine receptors such as IL-2, IL-4, IL-7, IL-9 and IL-15. IL-21 shows having much relation with clinical illnesses, including cancer immunotherapy, viral infections and allergies. Mature rat IL-21 shares 88% a.a. sequence identity with mouse IL-21. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human N1186 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg. |
Molecular Mass : |
Approximately 15.2 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids. |
AA Sequence : |
HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : |
Less than 1 EU/μg of rRtIL-21 as determined by LAL method. |
Purity : |
>96% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |