Recombinant Rat Il21 protein
Cat.No. : | Il21-581R |
Product Overview : | Recombinant Rat Il21 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Protein Length : | 129 |
Description : | Rat IL-21 is produced by CD4+ T cells in response to antigenic stimulation and can regulating immune system cells, for instance cytotoxin T cells and natural killer cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells, stimulation with IL-4 of IgG production, and induction of apoptotic effects in naïve B-cells and stimulated B-cells in the absence of T-cell signaling. Additionally, it promotes the anti-tumor activity of CD8+ T-cells and NK cells. IL-21 elicits its effect through binding to IL-21R, which also contains the gamma chain found in other cytokine receptors such as IL-2, IL-4, IL-7, IL-9 and IL-15. IL-21 shows having much relation with clinical illnesses, including cancer immunotherapy, viral infections and allergies. Mature rat IL-21 shares 88% a.a. sequence identity with mouse IL-21. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human N1186 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg. |
Molecular Mass : | Approximately 15.2 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids. |
AA Sequence : | HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : | Less than 1 EU/μg of rRtIL-21 as determined by LAL method. |
Purity : | >96% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il21 |
Official Symbol | Il21 |
Synonyms | Za11 |
Gene ID | 365769 |
mRNA Refseq | NM_001108943 |
Protein Refseq | NP_001102413 |
UniProt ID | A3QPB9 |
◆ Recombinant Proteins | ||
IL21-161H | Active Recombinant Human IL21 Protein | +Inquiry |
Il21-6742M | Recombinant Mouse Il21 Protein (Pro25-Ser146), N-His tagged | +Inquiry |
IL21-378R | Recombinant Rat Il21, His tagged | +Inquiry |
Il21-007I | Active Recombinant Rat Il21 Protein (129 aa) | +Inquiry |
IL21-6949Z | Recombinant Zebrafish IL21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il21 Products
Required fields are marked with *
My Review for All Il21 Products
Required fields are marked with *
0
Inquiry Basket