Recombinant Rat Il21 protein

Cat.No. : Il21-581R
Product Overview : Recombinant Rat Il21 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Protein Length : 129
Description : Rat IL-21 is produced by CD4+ T cells in response to antigenic stimulation and can regulating immune system cells, for instance cytotoxin T cells and natural killer cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells, stimulation with IL-4 of IgG production, and induction of apoptotic effects in naïve B-cells and stimulated B-cells in the absence of T-cell signaling. Additionally, it promotes the anti-tumor activity of CD8+ T-cells and NK cells. IL-21 elicits its effect through binding to IL-21R, which also contains the gamma chain found in other cytokine receptors such as IL-2, IL-4, IL-7, IL-9 and IL-15. IL-21 shows having much relation with clinical illnesses, including cancer immunotherapy, viral infections and allergies. Mature rat IL-21 shares 88% a.a. sequence identity with mouse IL-21.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human N1186 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 15.2 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids.
AA Sequence : HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS
Endotoxin : Less than 1 EU/μg of rRtIL-21 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il21
Official Symbol Il21
Synonyms Za11
Gene ID 365769
mRNA Refseq NM_001108943
Protein Refseq NP_001102413
UniProt ID A3QPB9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il21 Products

Required fields are marked with *

My Review for All Il21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon