Active Recombinant Rat Il21 Protein (129 aa)
Cat.No. : | Il21-007I |
Product Overview : | Recombinant Rat Il21 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 129 |
Description : | IL-21 is a pleiotropic cytokine produced by CD4+ T cells in response to antigenic stimulation. Its action generally enhances antigen-specific responses of immune cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells, stimulation (in conjuction) with IL-4 of IgG production, and induction of apoptotic effects in naïve B-cells and stimulated B-cells in the absence of T-cell signaling. Additionally, IL-21 promotes the anti-tumor activity of CD8+ T-cells and NK cells. IL-21 exerts its effect through binding to a specific type I cytokine receptor, IL-21R, which also contains the gamma chain (γc) found in other cytokine receptors including IL-2, IL-4, IL-7, IL-9 and IL-15. The IL-21/IL-21R interaction triggers a cascade of events which includes activation of the tyrosine kinases JAK1 and JAK3, followed by activation of the transcription factors STAT1 and STAT3. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured by its ability to inhibit IL21dependent proliferation of N1186 human T cells. The ED50 for this effect is typically 1-5 μg/mL in the presence of 50 ng/mL of recombinant mouse IL21. |
Molecular Mass : | Approximately 15.2 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids. |
AA Sequence : | HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS |
Endotoxin : | Less than 1 EU/μg of rRtIL-21 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il21 interleukin 21 [ Rattus norvegicus ] |
Official Symbol | Il21 |
Synonyms | IL21; interleukin 21; interleukin-21; IL-21; |
Gene ID | 365769 |
mRNA Refseq | NM_001108943 |
Protein Refseq | NP_001102413 |
UniProt ID | A3QPB9 |
◆ Recombinant Proteins | ||
IL21-2694R | Recombinant Rat IL21 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL21-2122H | Active Recombinant Human IL21 protein | +Inquiry |
Il21-1805M | Recombinant Mouse Il21 protein, His & GST-tagged | +Inquiry |
Il21-01M | Active Recombinant Mouse Il21 Protein, His-Tagged | +Inquiry |
Il21-153M | Active Recombinant Mouse Il21 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21-001RCL | Recombinant Rat IL21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il21 Products
Required fields are marked with *
My Review for All Il21 Products
Required fields are marked with *
0
Inquiry Basket