Active Recombinant Rat Il21 Protein (129 aa)

Cat.No. : Il21-007I
Product Overview : Recombinant Rat Il21 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 129
Description : IL-21 is a pleiotropic cytokine produced by CD4+ T cells in response to antigenic stimulation. Its action generally enhances antigen-specific responses of immune cells. The biological effects of IL-21 include induction of differentiation of T-cells-stimulated B-cells into plasma cells and memory B-cells, stimulation (in conjuction) with IL-4 of IgG production, and induction of apoptotic effects in naïve B-cells and stimulated B-cells in the absence of T-cell signaling. Additionally, IL-21 promotes the anti-tumor activity of CD8+ T-cells and NK cells. IL-21 exerts its effect through binding to a specific type I cytokine receptor, IL-21R, which also contains the gamma chain (γc) found in other cytokine receptors including IL-2, IL-4, IL-7, IL-9 and IL-15. The IL-21/IL-21R interaction triggers a cascade of events which includes activation of the tyrosine kinases JAK1 and JAK3, followed by activation of the transcription factors STAT1 and STAT3.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured by its ability to inhibit IL21dependent proliferation of N1186 human T cells. The ED50 for this effect is typically 1-5 μg/mL in the presence of 50 ng/mL of recombinant mouse IL21.
Molecular Mass : Approximately 15.2 kDa, a single non-glycosylated polypeptide chain containing 129 amino acids.
AA Sequence : HKSSPQRPDHLLIRLRHLMDIVEQLKIYENDLDPELLTAPQDVKGQCEHEAFACFQKAKLKPSNTGNNKTFINDLLAQLRRRLPAKRTGNKQRHMAKCPSCDLYEKKTPKEFLERLKWLLQKMIHQHLS
Endotoxin : Less than 1 EU/μg of rRtIL-21 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Il21 interleukin 21 [ Rattus norvegicus ]
Official Symbol Il21
Synonyms IL21; interleukin 21; interleukin-21; IL-21;
Gene ID 365769
mRNA Refseq NM_001108943
Protein Refseq NP_001102413
UniProt ID A3QPB9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il21 Products

Required fields are marked with *

My Review for All Il21 Products

Required fields are marked with *

0
cart-icon