Recombinant Human GIPC PDZ Domain Containing Family, Member 2, His-tagged
| Cat.No. : | GIPC2-1400H |
| Product Overview : | Recombinant human GIPC2protein,fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | GIPC2 contains 315amino acid protein that localizes to the cytoplasm and contains one PDZdomain. GIPC2 is expressed at high levels in kidney and colon and at lowerlevels in adult liver. It might play important roles in human gastric cancerthrough modulation of growth factor signaling or cell adhesion. |
| Form : | Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 0.1M NaCl. |
| Molecular Weight : | 36.9 kDa(339aa), confirmed by MALDI-TOF. |
| Purity : | > 95%by SDS-PAGE |
| Concentration : | 1 mg/ml(determined by Bradford assay) |
| Sequences of aminoacids : | MGSSHHHHHHSSGLVPRGSH MGSHMPLKLR GKKKAKSKET AGLVEGEPTG AGGGSLSASR APARRLVFHAQLAHGSATGR VEGFSSIQEL YAQIAGAFEI SPSEILYCTL NTPKIDMERLLGGQLGLEDF IFAHVKGIEK EVNVYKSEDS LGLTITDNGV GYAFIKRIKD GGVIDSVKTI CVGDHIESINGENIVGWRHY DVAKKLKELK KEELFTMKLI EPKKAFEIEP RSKAGKSSGE KIGCGRATLR LRSKGPATVEEMPSETKAKAIEKIDDVLELYMGIRDIDLA TTMFEAGKDK VNPDEFAVAL DETLGDFAFP DEFVFDVWGV IGDAKRRGL |
| Storage : | Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
| OfficialSymbol : | GIPC2 |
| Gene Name | GIPC2GIPC PDZ domain containing family, member 2 [ Homo sapiens ] |
| Synonyms | GIPC2; GIPC PDZ domain containing family, member 2; SEMCAP2;FLJ20075; SEMCAP-2; PDZ domain-containingprotein GIPC2; PDZ domain protein GIPC2; semaF cytoplasmic domain associatedprotein 2; semaphorin cytoplasmic domain associated protein 2; OTTHUMP00000038608 |
| Gene ID | 54810 |
| mRNA Refseq | NM_017655 |
| Protein Refseq | NP_060125 |
| UniProt ID | Q8TF65 |
| Chromosome Location | 1p31.1 |
| ◆ Recombinant Proteins | ||
| GIPC2-11169Z | Recombinant Zebrafish GIPC2 | +Inquiry |
| GIPC2-2198R | Recombinant Rat GIPC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GIPC2-3566M | Recombinant Mouse GIPC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GIPC2-3114H | Recombinant Human GIPC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GIPC2-5277HF | Recombinant Full Length Human GIPC2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GIPC2-5927HCL | Recombinant Human GIPC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIPC2 Products
Required fields are marked with *
My Review for All GIPC2 Products
Required fields are marked with *
