"GIPC2" Related Products

Expand
Expand

Recombinant Human GIPC PDZ Domain Containing Family, Member 2, His-tagged

Cat. No.: GIPC2-1400H
Product Overview: Recombinant human GIPC2protein,fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography techniques.
Description: GIPC2 contains 315amino acid protein that localizes to the cytoplasm and contains one PDZdomain. GIPC2 is expressed at high levels in kidney and colon and at lowerlevels in adult liver. It might play important roles in human gastric cancerthrough modulation of growth factor signaling or cell adhesion.
Form: Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 30% glycerol, 0.1M NaCl.
Molecular Weight: 36.9 kDa(339aa), confirmed by MALDI-TOF.
Purity: > 95%by SDS-PAGE
Concentration: 1 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMPLKLR GKKKAKSKET AGLVEGEPTG AGGGSLSASR APARRLVFHAQLAHGSATGR VEGFSSIQEL YAQIAGAFEI SPSEILYCTL NTPKIDMERLLGGQLGLEDF IFAHVKGIEK EVNVYKSEDS LGLTITDNGV GYAFIKRIKD GGVIDSVKTI CVGDHIESINGENIVGWRHY DVAKKLKELK KEELFTMKLI EPKKAFEIEP RSKAGKSSGE KIGCGRATLR LRSKGPATVEEMPSETKAKAIEKIDDVLELYMGIRDIDLA TTMFEAGKDK VNPDEFAVAL DETLGDFAFP DEFVFDVWGV IGDAKRRGL
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
OfficialSymbol: GIPC2
Gene Name: GIPC2GIPC PDZ domain containing family, member 2 [ Homo sapiens ]
Synonyms: GIPC2; GIPC PDZ domain containing family, member 2; SEMCAP2;FLJ20075; SEMCAP-2; PDZ domain-containingprotein GIPC2; PDZ domain protein GIPC2; semaF cytoplasmic domain associatedprotein 2; semaphorin cytoplasmic domain associated protein 2; OTTHUMP00000038608
Gene ID: 54810
mRNA Refseq: NM_017655
Protein Refseq: NP_060125
UniProt ID: Q8TF65
Chromosome Location: 1p31.1

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.