Recombinant Human SHBG protein, His-tagged

Cat.No. : SHBG-3742H
Product Overview : Recombinant human SHBG was expressed in CHO cells with C-Terminal His-tag + myc-epitope.
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : CHO
Tag : His
Protein Length : 428 AA
Description : Sex-hormone-binding globulin (SHBG) is a beta-globulin that specifically binds steroid hormones. Its molecular weight is 86 kDa/mol. The major site of SHBG synthesis is thought to be the hepatocytes. Its production is regulated by androgen/estrogen balance, thyroid hormones, insulin and dietary factors, among others. SHBG is involved in the transport of sex steroids in plasma. Its concentration is a major factor regulating their distribution between protein-bound and free states. Determination of SHBG concentration is mainly of importance in the evaluation of mild disorders of androgen metabolism and it allows identification of women with hirsutism who are likely to respond to estrogen therapy. Testosterone/SHBG-ratios correlate well with both measured and calculated values for free testosterone, and help to discriminate between subjects with excessive androgen activity and normal individuals.
Form : Frozen, stabilized and concentrated medium
Molecular Mass : 46.79 kDa (calculated); 94kDa (forms a dimer)
AA Sequence : AAQPARRARRTKLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASHSRGGPEQKLISEEDLNSAVDHHHHHH
Applications : ELISA standard; Standard for Immunoanalytical methods
Notes : This product is intended for research use only.
Storage : Store at -80 centigrade.
Gene Name Sex hormone binding globulin [Homo sapiens (human)]
Official Symbol SHBG
Synonyms ABP; SBP; TEBG; SHBG, Sex steroid-binding protein; Testisspecific androgen-binding protein; Testosterone-estradiolbinding globulin; Testosterone-estrogen-binding globulin
Gene ID 6462
mRNA Refseq NM_001040.3
Protein Refseq NP_001031.2
MIM 182205
UniProt ID P04278

Regulation of Prostate Androgens by Megalin and 25-hydroxyvitamin D Status: Mechanism for High Prostate Androgens in African American Men

Journal: Cancer Research Communications    Data: 2023/3/1

Authors: Jason Garcia, Kirsten D. Krieger, Larisa Nonn

Article Snippet: Recombinant human SHBG (catalog no. SHBG-8259H, Creative BioMart) was directly labeled with Alexa Fluor-555 using a protein conjugation kit (catalog no. A20174, Thermo Fisher Scientific) according to the manufacturer's protocol.. Aliquots of the globulin conjugate SHBG-555 were stored at ?20°C until use.Aliquots of the globulin conjugate SHBG-555 were stored at ?20°C until use.

Vitamin D deficiency increases prostatic megalin expression and globulin-bound testosterone import, increasing prostatic androgens in African American men

Journal: bioRxiv    Data: 2021/11/12

Authors: Garcia Jason, Krieger Kirstin D., Nonn Larisa

Article Snippet:PrePrint: LAPC-4 and 22Rv1 cells at 80% confluency were incubated with 25 nM T ± 125 nM human SHBG (SHBG-8259H, Creative BioMart) and 1 μM receptor-associated protein (MEG-Inh) (BML-SE552-0100, Enzo Life Sciences) for 16 h. T and SHBG were preincubated for 30 min before addition to cells.. Cells were pretreated with megalin inhibitor for 1 h before hormone addition.Cells were pretreated with megalin inhibitor for 1 h before hormone addition.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SHBG Products

Required fields are marked with *

My Review for All SHBG Products

Required fields are marked with *

0
cart-icon
0
compare icon