Recombinant Human SHBG protein, His-tagged
| Cat.No. : | SHBG-3742H |
| Product Overview : | Recombinant human SHBG was expressed in CHO cells with C-Terminal His-tag + myc-epitope. |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | His |
| Protein Length : | 428 AA |
| Description : | Sex-hormone-binding globulin (SHBG) is a beta-globulin that specifically binds steroid hormones. Its molecular weight is 86 kDa/mol. The major site of SHBG synthesis is thought to be the hepatocytes. Its production is regulated by androgen/estrogen balance, thyroid hormones, insulin and dietary factors, among others. SHBG is involved in the transport of sex steroids in plasma. Its concentration is a major factor regulating their distribution between protein-bound and free states. Determination of SHBG concentration is mainly of importance in the evaluation of mild disorders of androgen metabolism and it allows identification of women with hirsutism who are likely to respond to estrogen therapy. Testosterone/SHBG-ratios correlate well with both measured and calculated values for free testosterone, and help to discriminate between subjects with excessive androgen activity and normal individuals. |
| Form : | Frozen, stabilized and concentrated medium |
| Molecular Mass : | 46.79 kDa (calculated); 94kDa (forms a dimer) |
| AA Sequence : | AAQPARRARRTKLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDIPQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPLVLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTSFCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASHSRGGPEQKLISEEDLNSAVDHHHHHH |
| Applications : | ELISA standard; Standard for Immunoanalytical methods |
| Notes : | This product is intended for research use only. |
| Storage : | Store at -80 centigrade. |
| Gene Name | Sex hormone binding globulin [Homo sapiens (human)] |
| Official Symbol | SHBG |
| Synonyms | ABP; SBP; TEBG; SHBG, Sex steroid-binding protein; Testisspecific androgen-binding protein; Testosterone-estradiolbinding globulin; Testosterone-estrogen-binding globulin |
| Gene ID | 6462 |
| mRNA Refseq | NM_001040.3 |
| Protein Refseq | NP_001031.2 |
| MIM | 182205 |
| UniProt ID | P04278 |
| ◆ Recombinant Proteins | ||
| SHBG-8140M | Recombinant Mouse SHBG Protein, His (Fc)-Avi-tagged | +Inquiry |
| SHBG-583H | Recombinant Human SHBG Protein, His-tagged | +Inquiry |
| Shbg-5853M | Recombinant Mouse Shbg Protein, Myc/DDK-tagged | +Inquiry |
| SHBG-6282H | Recombinant Human SHBG Protein (Met1-His402), C-His tagged | +Inquiry |
| SHBG-1645Z | Recombinant Zebrafish SHBG | +Inquiry |
| ◆ Native Proteins | ||
| SHBG-30637TH | Native Human SHBG protein | +Inquiry |
| SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
| SHBG-8259H | Native Human Serum Sex Hormone Binding Globulin | +Inquiry |
Regulation of Prostate Androgens by Megalin and 25-hydroxyvitamin D Status: Mechanism for High Prostate Androgens in African American Men
Journal: Cancer Research Communications Data: 2023/3/1
Authors: Jason Garcia, Kirsten D. Krieger, Larisa Nonn
Article Snippet: Recombinant human SHBG (catalog no. SHBG-8259H, Creative BioMart) was directly labeled with Alexa Fluor-555 using a protein conjugation kit (catalog no. A20174, Thermo Fisher Scientific) according to the manufacturer's protocol.. Aliquots of the globulin conjugate SHBG-555 were stored at ?20°C until use.Aliquots of the globulin conjugate SHBG-555 were stored at ?20°C until use.
Vitamin D deficiency increases prostatic megalin expression and globulin-bound testosterone import, increasing prostatic androgens in African American men
Journal: bioRxiv Data: 2021/11/12
Authors: Garcia Jason, Krieger Kirstin D., Nonn Larisa
Article Snippet:PrePrint: LAPC-4 and 22Rv1 cells at 80% confluency were incubated with 25 nM T ± 125 nM human SHBG (SHBG-8259H, Creative BioMart) and 1 μM receptor-associated protein (MEG-Inh) (BML-SE552-0100, Enzo Life Sciences) for 16 h. T and SHBG were preincubated for 30 min before addition to cells.. Cells were pretreated with megalin inhibitor for 1 h before hormone addition.Cells were pretreated with megalin inhibitor for 1 h before hormone addition.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SHBG Products
Required fields are marked with *
My Review for All SHBG Products
Required fields are marked with *
