"HBV" Related Products

Expand

Recombinant HBV Surface Antigen preS2 protein

Cat.No. : HBV-06
Product Overview : Recombinant HBV Surface Antigen preS2 protein was expressed in Escherichia coli.
Source : E.coli
Species : HBV
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Molecular Mass : Approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids.
Protein length : 55
AA Sequence : MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN
Endotoxin : Less than 1 EU/μg of rHBsAg-preS2 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Applications : 1. Immunochromatography (capture and conjugate);2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2;3. ELISA.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.