Recombinant HBV Surface Antigen preS2 protein

Cat.No. : HBV-06
Product Overview : Recombinant HBV Surface Antigen preS2 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : HBV
Source : E.coli
Tag : Non
Protein Length : 55
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Molecular Mass : Approximately 5.7 kDa, a single non-glycosylated polypeptide chain containing 55 amino acids.
AA Sequence : MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN
Endotoxin : Less than 1 EU/μg of rHBsAg-preS2 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Applications : 1. Immunochromatography (capture and conjugate);2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2;3. ELISA.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBV Products

Required fields are marked with *

My Review for All HBV Products

Required fields are marked with *

0
cart-icon
0
compare icon