Recombinant Human ALS2CR8 protein, GST-tagged
Cat.No. : | ALS2CR8-9603H |
Product Overview : | Recombinant Human ALS2CR8 protein(1-311 aa ), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-311 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRDSSFGQNDSPTVLPITTREANNSLISQNIPGPLTQTQTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIVASPTENGQVLRVIPPTQTGMAQVIIPQGQLVDVNSPRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLPKKSVTGMLEEPLLGPLQPLSSNTPIWACRLRSCEKIGDSYRGYCVSETELESVLTFHKQQTQSVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGFQLKKVSEQESRSCQLY |
Gene Name | ALS2CR8 amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 8 [ Homo sapiens ] |
Official Symbol | ALS2CR8 |
Synonyms | ALS2CR8; amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 8; amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein; calcium response factor; CaRF; FLJ21579; NYD SP24; calcium-response factor; testis development protein NYD-SP24; CARF; NYD-SP24; FLJ12675; DKFZp667N246; |
Gene ID | 79800 |
mRNA Refseq | NM_001104586 |
Protein Refseq | NP_001098056 |
MIM | 607586 |
UniProt ID | Q8N187 |
◆ Recombinant Proteins | ||
ALS2CR8-300R | Recombinant Rat ALS2CR8 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALS2CR8-1303HF | Recombinant Full Length Human ALS2CR8 Protein, GST-tagged | +Inquiry |
ALS2CR8-509H | Recombinant Human ALS2CR8 protein, GST-tagged | +Inquiry |
ALS2CR8-644R | Recombinant Rat ALS2CR8 Protein | +Inquiry |
ALS2CR8-9603H | Recombinant Human ALS2CR8 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALS2CR8-68HCL | Recombinant Human ALS2CR8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALS2CR8 Products
Required fields are marked with *
My Review for All ALS2CR8 Products
Required fields are marked with *