Recombinant Human ANKRD10 protein, His-tagged

Cat.No. : ANKRD10-9664H
Product Overview : Recombinant Human ANKRD10 protein(1-151 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : His
Protein Length : 1-151 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MSAAGAGAGVEAGFSSEELLSLRFPLHRACRDGDLATLCSLLQQTPHAHLASEDSFYGWTPVHWAAHFGKLECLVQLVRAGATLNVSTTRYAQTPAHIAAFGGHPQCLVWLIQAGANINKPDCEGETPIHKAARSGSLECISALVANGAHV
Purity : 90%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
MIM-Weblink :  
Gene Name ANKRD10 ankyrin repeat domain 10 [ Homo sapiens ]
Official Symbol ANKRD10
Synonyms Ankrd10; Ankyrin repeat domain-containing protein 10; ANR10_HUMAN; RP11-120J20.3; ANKRD10
mRNA Refseq NM_017664.2
Protein Refseq NP_060134.2
UniProt ID Q9NXR5
Gene ID 55608

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD10 Products

Required fields are marked with *

My Review for All ANKRD10 Products

Required fields are marked with *

0
cart-icon
0
compare icon