Recombinant Human DERL2 protein, His-tagged
| Cat.No. : | DERL2-11941H |
| Product Overview : | Recombinant Human DERL2 protein(1-70 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 25, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-70 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITNFLFFGPVGFN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | DERL2 Der1-like domain family, member 2 [ Homo sapiens ] |
| Official Symbol | DERL2 |
| Synonyms | DERL2; Der1-like domain family, member 2; derlin-2; CGI 101; derlin 2; F LAN 1; F LANa; FLANa; DERtrin-2; carcinoma related; der1-like protein 2; degradation in endoplasmic reticulum protein 2; F-LANa; CGI-101; F-LAN-1; |
| Gene ID | 51009 |
| mRNA Refseq | NM_016041 |
| Protein Refseq | NP_057125 |
| MIM | 610304 |
| UniProt ID | Q9GZP9 |
| ◆ Recombinant Proteins | ||
| Derl2-584M | Recombinant Mouse Derl2 Protein, MYC/DDK-tagged | +Inquiry |
| DERL2-3002Z | Recombinant Zebrafish DERL2 | +Inquiry |
| RFL32737HF | Recombinant Full Length Human Derlin-2(Derl2) Protein, His-Tagged | +Inquiry |
| DERL2-1245R | Recombinant Rhesus monkey DERL2 Protein, His-tagged | +Inquiry |
| DERL2-2791H | Recombinant Human DERL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DERL2-6970HCL | Recombinant Human DERL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DERL2 Products
Required fields are marked with *
My Review for All DERL2 Products
Required fields are marked with *
