Recombinant Human DHRS7 protein, His-tagged

Cat.No. : DHRS7-11977H
Product Overview : Recombinant Human DHRS7 protein(27-183 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability January 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 27-183 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
AASequence : RADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQLSKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGGMSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQG
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name DHRS7 dehydrogenase/reductase (SDR family) member 7 [ Homo sapiens ]
Official Symbol DHRS7
Synonyms DHRS7; dehydrogenase/reductase (SDR family) member 7; dehydrogenase/reductase SDR family member 7; retDSR4; retinal short chain dehydrogenase/reductase 4; SDR34C1; short chain dehydrogenase/reductase family 34C; member 1; retinal short-chain dehydrogenase/reductase 4; short chain dehydrogenase/reductase family 34C, member 1; CGI-86; retSDR4;
Gene ID 51635
mRNA Refseq NM_016029
Protein Refseq NP_057113
MIM 612833
UniProt ID Q9Y394

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DHRS7 Products

Required fields are marked with *

My Review for All DHRS7 Products

Required fields are marked with *

0
cart-icon
0
compare icon