Recombinant Human GSTA2 protein, GST-tagged
| Cat.No. : | GSTA2-13570H |
| Product Overview : | Recombinant Human GSTA2 protein(1-222 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-222 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GSTA2 glutathione S-transferase alpha 2 [ Homo sapiens ] |
| Official Symbol | GSTA2 |
| Synonyms | GSTA2; glutathione S-transferase alpha 2; glutathione S transferase A2 , GST2; glutathione S-transferase A2; GST-gamma; liver GST2; GST HA subunit 2; GST class-alpha member 2; glutathione S-aryltransferase A2; glutathione S-alkyltransferase A2; glutathione S-aralkyltransferase A2; S-(hydroxyalkyl)glutathione lyase A2; GST2; GTA2; GTH2; GSTA2-2; MGC10525; |
| Gene ID | 2939 |
| mRNA Refseq | NM_000846 |
| Protein Refseq | NP_000837 |
| MIM | 138360 |
| UniProt ID | P09210 |
| ◆ Recombinant Proteins | ||
| GSTA2-4410H | Recombinant Human GSTA2 Protein, GST-tagged | +Inquiry |
| GSTA2-7325M | Recombinant Mouse GSTA2 Protein | +Inquiry |
| GSTA2-1666HFL | Recombinant Full Length Human GSTA2 Protein, C-Flag-tagged | +Inquiry |
| GSTA2-3967M | Recombinant Mouse GSTA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GSTA2-2551H | Recombinant Human GSTA2 Protein (Met1-Phe222), His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GSTA2-5718HCL | Recombinant Human GSTA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSTA2 Products
Required fields are marked with *
My Review for All GSTA2 Products
Required fields are marked with *
