Recombinant Human BTD, His-tagged

Cat.No. : BTD-46H
Product Overview : Recombinant Human Biotinidase/BTD is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ala42-Asp543) of Human BTD fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 42-543 a.a.
Description : Biotinidase is a secreted enzyme that belongs to the CN hydrolase family of BTD/VNN subfamily. Biotinidase Contains 1 CN hydrolase domain. Biotinidase allows the body to use and to recycle the B vitamin biotin, sometimes called vitamin H. Biotinidase extracts biotin from food because the body needs biotin in its free, unattached form. This enzyme also recycles biotin from enzymes in the body that use it as a helper component in order to function. Biotinidase catalyzes release of biotin from biocytin, the product of biotin-dependent carboxylases degradation. These enzymes, known as carboxylases, are important in the processing of fats, carbohydrates, and proteins. Biotin is attached to these carboxylase enzymes through lysine, forming a complex called biocytin. Biotinidase removes biotin from biocytin and makes it available to be reused by other enzymes. Defects in Biotinidase causes biotinidase deficiency, which is a multiple carboxylase deficiency, characterized by seizures, hypotonia, skin rash, alopecia, ataxia, hearing loss, and optic atrophy.
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5
AA Sequence : AHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQ IIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVA NLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPF AGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANV HHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILS GDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERP TLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIF PLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERDVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.
Gene Name BTD biotinidase [ Homo sapiens ]
Official Symbol BTD
Synonyms BTD; biotinidase; biotinase;
Gene ID 686
mRNA Refseq NM_000060
Protein Refseq NP_000051
MIM 609019
UniProt ID P43251
Chromosome Location 3p25
Pathway Biotin metabolism, organism-specific biosystem; Biotin metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Vitamin digestion and absorption, organism-specific biosystem; Vitamin digestion and absorption, conserved biosystem;
Function biotin carboxylase activity; biotinidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTD Products

Required fields are marked with *

My Review for All BTD Products

Required fields are marked with *

0
cart-icon
0
compare icon