"BTD" Related Products

Expand
Expand
Expand

Recombinant Human BTD, His-tagged

Cat.No.: BTD-46H
Product Overview: Recombinant Human Biotinidase/BTD is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Ala42-Asp543) of Human BTD fused with a polyhistidine tag at the C-terminus.
Description: Biotinidase is a secreted enzyme that belongs to the CN hydrolase family of BTD/VNN subfamily. Biotinidase Contains 1 CN hydrolase domain. Biotinidase allows the body to use and to recycle the B vitamin biotin, sometimes called vitamin H. Biotinidase extracts biotin from food because the body needs biotin in its free, unattached form. This enzyme also recycles biotin from enzymes in the body that use it as a helper component in order to function. Biotinidase catalyzes release of biotin from biocytin, the product of biotin-dependent carboxylases degradation. These enzymes, known as carboxylases, are important in the processing of fats, carbohydrates, and proteins. Biotin is attached to these carboxylase enzymes through lysine, forming a complex called biocytin. Biotinidase removes biotin from biocytin and makes it available to be reused by other enzymes. Defects in Biotinidase causes biotinidase deficiency, which is a multiple carboxylase deficiency, characterized by seizures, hypotonia, skin rash, alopecia, ataxia, hearing loss, and optic atrophy.
Source: HEK293
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 7.5
AA Sequence: AHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQ IIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVA NLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPF AGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANV HHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILS GDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERP TLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIF PLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERDVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at Please minimize freeze-thaw cycles.
Gene Name: BTD biotinidase [ Homo sapiens ]
Official Symbol: BTD
Synonyms: BTD; biotinidase; biotinase;
Gene ID: 686
mRNA Refseq: NM_000060
Protein Refseq: NP_000051
MIM: 609019
UniProt ID: P43251
Chromosome Location: 3p25
Pathway: Biotin metabolism, organism-specific biosystem; Biotin metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; Vitamin digestion and absorption, organism-specific biosystem; Vitamin digestion and absorption, conserved biosystem;
Function: biotin carboxylase activity; biotinidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.