"FAH" Related Products

Expand
Expand
Expand

Recombinant Human FAH, His-tagged

Cat.No.: FAH-85H
Product Overview: Recombinant Human Fumarylacetoacetase/FAH is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser2-Ser419) of Human FAH fused with a polyhistidine tag at the C-terminus.
Description: Fumarylacetoacetase belongs to the FAH family. Fumarylacetoacetase is primary expressed in liver and kidney. It exists as a homodimer and catalyzes the hydrolysis of 4-fumarylacetoacetate into fumarate and acetoacetate. Defects in Fumarylacetoacetase cause tyrosinemia type 1, which is congenital metabolism defect characterized by elevated levels of tyrosine in the blood and urine, and hepatorenal manifestations. Typical features include renal tubular injury, self-mutilation, hepatic necrosis, episodic weakness, and seizures.
Source: HEK293
Species: Human
Tag: His
Form: Ser2-Ser419
AA Sequence: MSFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFTGPVLSKHQDVFNQP TLNSFMGLGQAAWKEARVFLQNLLSVSQARLRDDTELRKCAFISQASATMHLPATIGDYTDFYSS RQHATNVGIMFRDKENALMPNWLHLPVGYHGRASSVVVSGTPIRRPMGQMKPDDSKPPVYGACKL LDMELEMAFFVGPGNRLGEPIPISKAHEHIFGMVLMNDWSARDIQKWEYVPLGPFLGKSFGTTVS PWVVPMDALMPFAVPNPKQDPRPLPYLCHDEPYTFDINLSVNLKGEGMSQAATICKSNFKYMYWT MLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFGSMLELSWKGTKPIDLGNGQTRKFLLDGDEV IITGYCQGDGYRIGFGQCAGKVLPALLPSVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: FAH fumarylacetoacetate hydrolase (fumarylacetoacetase) [ Homo sapiens ]
Official Symbol: FAH
Synonyms: FAH; fumarylacetoacetate hydrolase (fumarylacetoacetase); fumarylacetoacetase; FAA; beta-diketonase; FLJ51912;
Gene ID: 2184
mRNA Refseq: NM_000137
Protein Refseq: NP_000128
MIM: 613871
UniProt ID: P16930
Chromosome Location: 15q23-q25
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Phenylalanine and tyrosine catabolism, organism-specific biosystem; Tyrosine degradation, tyrosine => homogentisate, organism-specific biosystem; Tyrosine degradation, tyrosine =>
Function: catalytic activity; fumarylacetoacetase activity; fumarylacetoacetase activity; hydrolase activity; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.