Recombinant Human POLRMT protein, His-tagged
Cat.No. : | POLRMT-1853H |
Product Overview : | Recombinant Human POLRMT protein(282-405 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | September 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 282-405 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | YVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | POLRMT polymerase (RNA) mitochondrial (DNA directed) [ Homo sapiens ] |
Official Symbol | POLRMT |
Synonyms | POLRMT; polymerase (RNA) mitochondrial (DNA directed); DNA-directed RNA polymerase, mitochondrial; APOLMT; h mtRPOL; MTRNAP; MTRPOL; h-mtRPOL; |
Gene ID | 5442 |
mRNA Refseq | NM_005035 |
Protein Refseq | NP_005026 |
MIM | 601778 |
UniProt ID | O00411 |
◆ Recombinant Proteins | ||
POLRMT-1578H | Recombinant Human POLRMT protein | +Inquiry |
POLRMT-27748TH | Recombinant Human POLRMT, His-tagged | +Inquiry |
POLRMT-1853H | Recombinant Human POLRMT protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLRMT-3019HCL | Recombinant Human POLRMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLRMT Products
Required fields are marked with *
My Review for All POLRMT Products
Required fields are marked with *