Recombinant Human PHF5A protein, GST-tagged

• Cat.No.: PHF5A-1681H
• Product Overview: Recombinant Human PHF5A protein(1-110 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-110 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: PHF5A PHD finger protein 5A [ Homo sapiens ]
• Official Symbol: PHF5A
• Synonyms: PHF5A; PHD finger protein 5A; PHD finger-like domain-containing protein 5A; bK223H9.2; INI; MGC1346; Rds3; SAP14b; SF3b14b; PHD-finger 5a; PHD finger-like domain protein 5A; splicing factor 3B associated 14 kDa protein; splicing factor 3B-associated 14 kDa protein
• Gene ID: 84844
• mRNA Refseq: NM_032758
• Protein Refseq: NP_116147
• UniProt ID: Q7RTV0