Recombinant Human PHF5A protein, GST-tagged
Cat.No. : | PHF5A-1681H |
Product Overview : | Recombinant Human PHF5A protein(1-110 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | July 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-110 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | PHF5A PHD finger protein 5A [ Homo sapiens ] |
Official Symbol | PHF5A |
Synonyms | PHF5A; PHD finger protein 5A; PHD finger-like domain-containing protein 5A; bK223H9.2; INI; MGC1346; Rds3; SAP14b; SF3b14b; PHD-finger 5a; PHD finger-like domain protein 5A; splicing factor 3B associated 14 kDa protein; splicing factor 3B-associated 14 kDa protein; |
Gene ID | 84844 |
mRNA Refseq | NM_032758 |
Protein Refseq | NP_116147 |
UniProt ID | Q7RTV0 |
◆ Recombinant Proteins | ||
PHF5A-9538Z | Recombinant Zebrafish PHF5A | +Inquiry |
PHF5A-12730M | Recombinant Mouse PHF5A Protein | +Inquiry |
PHF5A-1681H | Recombinant Human PHF5A protein, GST-tagged | +Inquiry |
PHF5A-4790C | Recombinant Chicken PHF5A | +Inquiry |
PHF5A-6693M | Recombinant Mouse PHF5A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHF5A-3226HCL | Recombinant Human PHF5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHF5A Products
Required fields are marked with *
My Review for All PHF5A Products
Required fields are marked with *