Recombinant Human RNMT protein, GST-tagged
Cat.No. : | RNMT-2351H |
Product Overview : | Recombinant Human RNMT protein(128-476 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | October 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 128-476 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | KIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPYPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ |
Purity : | 95%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | RNMT RNA (guanine-7-) methyltransferase [ Homo sapiens ] |
Official Symbol | RNMT |
Synonyms | RNMT; RNA (guanine-7-) methyltransferase; mRNA cap guanine-N7 methyltransferase; RG7MT1; hMet; hCMT1; hcm1p; mRNA cap methyltransferase; mRNA (guanine-7-)methyltransferase; mRNA (guanine-N(7)-)-methyltransferase; MET; hCMT1c; KIAA0398; DKFZp686H1252; |
mRNA Refseq | NM_003799 |
Protein Refseq | NP_003790 |
MIM | 603514 |
UniProt ID | O43148 |
Gene ID | 8731 |
◆ Recombinant Proteins | ||
RNMT-14360M | Recombinant Mouse RNMT Protein | +Inquiry |
RNMT-863C | Recombinant Cynomolgus RNMT Protein, His-tagged | +Inquiry |
RNMT-4080Z | Recombinant Zebrafish RNMT | +Inquiry |
RNMT-1701C | Recombinant Canine RNMT protein, His-tagged | +Inquiry |
RNMT-4748R | Recombinant Rat RNMT Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNMT-2262HCL | Recombinant Human RNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNMT Products
Required fields are marked with *
My Review for All RNMT Products
Required fields are marked with *