Recombinant Mouse Apoa2, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Apoa2, GST-tagged

Recombinant Mouse Apoa2, GST-tagged

Apoa2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Apoa2-18M
Product Overview : Recombinant Mouse Apoa2 (24 a.a. - 102 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : Apolipoprotein A-II is a protein that in humans is encoded by the APOA2 gene.
Source : Wheat germ
Species : Mouse
Tag : GST
Molecular Mass : 34.32 kDa
AA Sequence : QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPA PAAK
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : Apoa2?apolipoprotein A-II [?Mus musculus?(house mouse) ]
Official Symbol : Apoa2
Synonyms : Apoa2; Alp-2; Hdl-1; ApoAII; Apoa-2; ApoA-II; apolipoprotein A-II; apo-AII; apolipoprotein A2
Gene ID : 11807
mRNA Refseq : NM_013474
Protein Refseq : NP_038502
UniProt ID : P09813
Chromosome Location : 1 H3; 1 79.22 cM
Pathway : Chylomicron-mediated lipid transport; Fatty acid, triacylglycerol, and ketone body metabolism; Metabolism of lipids and lipoproteins
Function : apolipoprotein receptor binding; cholesterol transporter activity; contributes_to cholesterol transporter activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.