Recombinant Mouse Apoa2, GST-tagged

Cat.No. : Apoa2-18M
Product Overview : Recombinant Mouse Apoa2 (24 a.a. - 102 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Wheat Germ
Tag : GST
Description : Apolipoprotein A-II is a protein that in humans is encoded by the APOA2 gene.
Molecular Mass : 34.32 kDa
AA Sequence : QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPA PAAK
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name Apoa2?apolipoprotein A-II [?Mus musculus?(house mouse) ]
Official Symbol Apoa2
Synonyms Apoa2; Alp-2; Hdl-1; ApoAII; Apoa-2; ApoA-II; apolipoprotein A-II; apo-AII; apolipoprotein A2
Gene ID 11807
mRNA Refseq NM_013474
Protein Refseq NP_038502
UniProt ID P09813
Chromosome Location 1 H3; 1 79.22 cM
Pathway Chylomicron-mediated lipid transport; Fatty acid, triacylglycerol, and ketone body metabolism; Metabolism of lipids and lipoproteins
Function apolipoprotein receptor binding; cholesterol transporter activity; contributes_to cholesterol transporter activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Apoa2 Products

Required fields are marked with *

My Review for All Apoa2 Products

Required fields are marked with *

0
cart-icon
0
compare icon