Recombinant Mouse Apoa2, GST-tagged

• Cat.No.: Apoa2-18M
• Product Overview: Recombinant Mouse Apoa2 (24 a.a. - 102 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Mouse
• Source: Wheat Germ
• Tag: GST
• Description: Apolipoprotein A-II is a protein that in humans is encoded by the APOA2 gene.
• Molecular Mass: 34.32 kDa
• AA Sequence: QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPA PAAK
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: Apoa2?apolipoprotein A-II [?Mus musculus?(house mouse) ]
• Official Symbol: Apoa2
• Synonyms: Apoa2; Alp-2; Hdl-1; ApoAII; Apoa-2; ApoA-II; apolipoprotein A-II; apo-AII; apolipoprotein A2
• Gene ID: 11807
• mRNA Refseq: NM_013474
• Protein Refseq: NP_038502
• UniProt ID: P09813
• Chromosome Location: 1 H3; 1 79.22 cM
• Pathway: Chylomicron-mediated lipid transport; Fatty acid, triacylglycerol, and ketone body metabolism; Metabolism of lipids and lipoproteins
• Function: apolipoprotein receptor binding; cholesterol transporter activity; contributes_to cholesterol transporter activity