"Apoa2" Related Products

Expand
Expand

Recombinant Mouse Apoa2, GST-tagged

Cat.No.: Apoa2-18M
Product Overview: Recombinant Mouse Apoa2 (24 a.a. - 102 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Apolipoprotein A-II is a protein that in humans is encoded by the APOA2 gene.
Source: Wheat germ
Species: Mouse
Tag: GST
Molecular Mass: 34.32 kDa
AA Sequence: QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPA PAAK
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: Apoa2?apolipoprotein A-II [?Mus musculus?(house mouse) ]
Official Symbol: Apoa2
Synonyms: Apoa2; Alp-2; Hdl-1; ApoAII; Apoa-2; ApoA-II; apolipoprotein A-II; apo-AII; apolipoprotein A2
Gene ID: 11807
mRNA Refseq: NM_013474
Protein Refseq: NP_038502
UniProt ID: P09813
Chromosome Location: 1 H3; 1 79.22 cM
Pathway: Chylomicron-mediated lipid transport; Fatty acid, triacylglycerol, and ketone body metabolism; Metabolism of lipids and lipoproteins
Function: apolipoprotein receptor binding; cholesterol transporter activity; contributes_to cholesterol transporter activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.