Recombinant Human NMU, His-tagged

Cat.No. : NMU-34H
Product Overview : A DNA sequence encoding human neuromedin-U (P48645) corresponding to amino acid (1-174) was expressed with a C-terminal polyhistidine tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 1-174 a.a.
Form : PBS pH7.4
Molecular Mass : The mature form of human neuromedin-U consists of 140 amino acids and has a predicted molecular mass of 16kDa.
AA Sequence : MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQAS NALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQS PFASQSRGYFLFRPRNGRRSAGFI
Purity : >90% as determined by SDS-PAGE
Storage : Store it at +4°C for short term. For long term storage, store it at -20°C - -70°C. Avoid freeze-thaw cycles.
Gene Name NMU neuromedin U [ Homo sapiens ]
Official Symbol NMU
Synonyms NMU; neuromedin U; neuromedin-U;
Gene ID 10874
mRNA Refseq NM_006681
Protein Refseq NP_006672
MIM 605103
UniProt ID P48645
Chromosome Location 4q12
Pathway Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function neuromedin U receptor binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NMU Products

Required fields are marked with *

My Review for All NMU Products

Required fields are marked with *

0
cart-icon
0
compare icon