"NMU" Related Products

Expand
Expand

Recombinant Human NMU, His-tagged

Cat.No.: NMU-34H
Product Overview: A DNA sequence encoding human neuromedin-U (P48645) corresponding to amino acid (1-174) was expressed with a C-terminal polyhistidine tag.
Source: HEK293
Species: Human
Tag: His
Form: PBS pH7.4
Molecular Mass: The mature form of human neuromedin-U consists of 140 amino acids and has a predicted molecular mass of 16kDa.
AA Sequence: MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQAS NALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQS PFASQSRGYFLFRPRNGRRSAGFI
Purity: >90% as determined by SDS-PAGE
Storage: Store it at +4°C for short term. For long term storage, store it at -20°C - -70°C. Avoid freeze-thaw cycles.
Gene Name: NMU neuromedin U [ Homo sapiens ]
Official Symbol: NMU
Synonyms: NMU; neuromedin U; neuromedin-U;
Gene ID: 10874
mRNA Refseq: NM_006681
Protein Refseq: NP_006672
MIM: 605103
UniProt ID: P48645
Chromosome Location: 4q12
Pathway: Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; Peptide ligand-binding receptors, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function: neuromedin U receptor binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.