Recombinant Human SLX4IP protein, Myc/DDK-tagged
Cat.No. : | SLX4IP-1288H |
Product Overview : | Recombinant Human SLX4IP protein, fused to Myc/DDK-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Recombinant protein of human chromosome 20 open reading frame 94 (C20orf94). |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Molecular Mass : | 45.4 kDa |
AA Sequence : | MASKKFAVKCGNFAVLVDLHILPQGSNKDTSWFSEQKKEEVCLLLKETIDSRVQEYLEVRKQHRPSNAEF TRSNPLSLKGYGFQITAYFLKRGIRLRCIRSTQNAELCVFPDRFVVCVSQLAFSRDLLASQNEDLTERVL HGVSDYFAECAESSLPPSAKLRRNALKEIVKRTETKSSVTSKSQTRRDTVETSSDSVIAEIARRRNDGQA SSSPPSESMGQAKDSIKAAESHWGLPVQKLEKVNQTQPEDTSGQQKPHPGERLKTGLLSRSPVCSCESAS PCPKQSPRVAKTQQKRRNCSSAEDFDHHGRVSLGSDRLVPREIIVEKSKAVRVLPASELSDPGLLLKQDL AKTTSKEELHVLESLSSRHLMKNNPGQAQQTGLATNTERLSTIQNSPTKKRKKYERGH |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name | SLX4IP SLX4 interacting protein [ Homo sapiens (human) ] |
Official Symbol | SLX4IP |
Synonyms | C20orf94; bA204H22.1; bA254M13.1; dJ1099D15.3 |
Gene ID | 128710 |
mRNA Refseq | NM_001009608 |
Protein Refseq | NP_001009608 |
MIM | 615958 |
UniProt ID | Q5VYV7 |
◆ Recombinant Proteins | ||
SLX4IP-1288H | Recombinant Human SLX4IP protein, Myc/DDK-tagged | +Inquiry |
SLX4IP-4769H | Recombinant Human SLX4IP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLX4IP-6744H | Recombinant Human SLX4IP protein, GST-tagged | +Inquiry |
SLX4IP-10722Z | Recombinant Zebrafish SLX4IP | +Inquiry |
Slx4ip-5948M | Recombinant Mouse Slx4ip Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLX4IP Products
Required fields are marked with *
My Review for All SLX4IP Products
Required fields are marked with *