"mRaspberry" Related Products

Purified fluorescent protein mRaspberry

Cat.No.: mRaspberry-17
Product Overview: Purified fluorescent protein mRaspberry, with N-terminal HIS tag, expressed in E. coli, 250ug
Source: E. coli
Tag: His
Molecular Mass: 25.4 kDa
AA Sequence: MVSKGEEVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQCMYGSKGYVK HPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSER MYPEDGALKGEMKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTG A
Purity: >80% as determined by SDS-PAGE and Coomassie blue staining
Concentration: >50 ug/mL as determined by microplate BCA method
Storage Buffer: PBS, pH7.4, 10% glycerol.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.