Purified fluorescent protein mRaspberry

Cat.No. : mRaspberry-17
Product Overview : Purified fluorescent protein mRaspberry, with N-terminal HIS tag, expressed in E. coli, 250ug
Availability October 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
Molecular Mass : 25.4 kDa
AA Sequence : MVSKGEEVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQCMYGSKGYVK HPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSER MYPEDGALKGEMKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTG A
Purity : >80% as determined by SDS-PAGE and Coomassie blue staining
Concentration : >50 ug/mL as determined by microplate BCA method
Storage Buffer : PBS, pH7.4, 10% glycerol.
Publications :
Measurement of 3-photon excitation and emission spectra and verification of Kasha’s rule for selected fluorescent proteins excited at the 1700-nm window (2019)

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All mRaspberry Products

Required fields are marked with *

My Review for All mRaspberry Products

Required fields are marked with *

0
cart-icon
0
compare icon