Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human INS therapeutic protein

Cat.No. : Insulin-P057H
Product Overview : Insulin glargine is produced by recombinant DNA technology using a non-pathogenic laboratory strain of Escherichia coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. Small amounts of insulin glargine are slowly released from microprecipitates giving the drug a long duration of action (up to 24 hours) and no pronounced peak concentration.
  • Specification
  • Gene Information
  • Related Products
Description : After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
Source : E. coli
Species : Human
Molecular Mass : 60.6 Kda
Protein length : 32aa
AA Sequence : FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : INS insulin [ Homo sapiens ]
Official Symbol : INS
Synonyms : INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID : 3630
mRNA Refseq : NM_000207
Protein Refseq : NP_000198
UniProt ID : P01308
Chromosome Location : 11p15.5
Pathway : ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function : hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All INS Products

Required fields are marked with *

My Review for All INS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends