Recombinant Human PARP16, GST-tagged PARP16-1129H

Recombinant Human PARP16, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PARP16, GST-tagged

Recombinant Human PARP16, GST-tagged

PARP16 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PARP16-1129H
Product Overview : Recombinant Human PARP16 full-length ORF(1 a.a - 323 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : Poly (ADP-ribose) polymerase family, member 16 is a protein in humans that is encoded by the PARP16 gene.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 62.9 kDa
AA Sequence : MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSS GDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYETKGERDLIYA FHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKC QTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYL LLLLIVSVINSSAFQHFWNRAKR
Applications : AP, Array, ELISA, WB-Re
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : PARP16 poly (ADP-ribose) polymerase family, member 16 [ Homo sapiens ]
Official Symbol : PARP16
Synonyms : ARTD15; pART15; C15orf30; mono [ADP-ribose] polymerase PARP16; ADP-ribosyltransferase diphtheria toxin-like 15; PARP-16; poly [ADP-ribose] polymerase 16; C15orf30, FLJ20509, FLJ25281
Gene ID : 54956
mRNA Refseq : NM_017851
Protein Refseq : NP_060321
UniProt ID : Q8N5Y8
Chromosome Location : 15q22.31
Function : NAD+ ADP-ribosyltransferase activity; kinase binding; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy