Recombinant Human PARP16, GST-tagged

Cat.No. : PARP16-1129H
Product Overview : Recombinant Human PARP16 full-length ORF(1 a.a - 323 a.a) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Poly (ADP-ribose) polymerase family, member 16 is a protein in humans that is encoded by the PARP16 gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 62.9 kDa
AA Sequence : MQPSGWAAAREAAGRDMLAADLRCSLFASALQSYKRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSS GDNHKRAWDLVSWILSSKVLTIHSAGKAEFEKIQKLTGAPHTPVPAPDFLFEIEYFDPANAKFYETKGERDLIYA FHGSRLENFHSIIHNGLHCHLNKTSLFGEGTYLTSDLSLALIYSPHGHGWQHSLLGPILSCVAVCEVIDHPDVKC QTKKKDSKEIDRRRARIKHSEGGDIPPKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYL LLLLIVSVINSSAFQHFWNRAKR
Applications : AP, Array, ELISA, WB-Re
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PARP16 poly (ADP-ribose) polymerase family, member 16 [ Homo sapiens ]
Official Symbol PARP16
Synonyms ARTD15; pART15; C15orf30; mono [ADP-ribose] polymerase PARP16; ADP-ribosyltransferase diphtheria toxin-like 15; PARP-16; poly [ADP-ribose] polymerase 16; C15orf30, FLJ20509, FLJ25281
Gene ID 54956
mRNA Refseq NM_017851
Protein Refseq NP_060321
UniProt ID Q8N5Y8
Chromosome Location 15q22.31
Function NAD+ ADP-ribosyltransferase activity; kinase binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PARP16 Products

Required fields are marked with *

My Review for All PARP16 Products

Required fields are marked with *

0
cart-icon