Recombinant Human H2AFX protein, GST-tagged H2AFX-68H

Recombinant Human H2AFX protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human H2AFX protein, GST-tagged

Recombinant Human H2AFX protein, GST-tagged

H2AFX Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : H2AFX-68H
Product Overview : Recombinant Human H2AFX (1 a.a. - 96 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.19 kDa
AA Sequence : MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK KTRIIPRHLQLAIRNDEELNK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : H2AFX H2A histone family, member X [ Homo sapiens ]
Official Symbol : H2AFX
Synonyms : H2AX; H2A.X; H2A/X; histone H2AX; H2AX histone; histone H2A.x
Gene ID : 3014
mRNA Refseq : NM_002105
Protein Refseq : NP_002096
MIM : 601772
UniProt ID : P16104
Chromosome Location : 11q23.3
Pathway : ATM mediated phosphorylation of repair proteins, organism-specific biosystem; ATM mediated response to DNA double-strand break, organism-specific biosystem; Alcoholism, organism-specific biosystem
Function : DNA binding; damaged DNA binding; enzyme binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Back to School Promotion

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy