Recombinant Human H2AFX protein, GST-tagged

Cat.No. : H2AFX-68H
Product Overview : Recombinant Human H2AFX (1 a.a. - 96 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-96 a.a.
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2A family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.19 kDa
AA Sequence : MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK KTRIIPRHLQLAIRNDEELNK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name H2AFX H2A histone family, member X [ Homo sapiens ]
Official Symbol H2AFX
Synonyms H2AX; H2A.X; H2A/X; histone H2AX; H2AX histone; histone H2A.x
Gene ID 3014
mRNA Refseq NM_002105
Protein Refseq NP_002096
MIM 601772
UniProt ID P16104
Chromosome Location 11q23.3
Pathway ATM mediated phosphorylation of repair proteins, organism-specific biosystem; ATM mediated response to DNA double-strand break, organism-specific biosystem; Alcoholism, organism-specific biosystem
Function DNA binding; damaged DNA binding; enzyme binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All H2AFX Products

Required fields are marked with *

My Review for All H2AFX Products

Required fields are marked with *

0
cart-icon
0
compare icon