"ALT" Related Products

    Recombinant ALT protein, His-tagged

    Cat.No. : ALT-116
    Product Overview : Recombinant ALT was expressed in E. coli.
    Source : E. coli
    Tag : His
    AA Sequence : MNKVLIIFGLVILLVTPLRAQEEDEMDDDEEFDGEDEGNDDSSSEGGDDGGDDSNDGGSNGGEDSEYVTKGKFVE TDGKKKQCNSHEACYDQREPQAWCILKKGQSWTNKGCFCEEKMNSCVIERKNGGNLEYAYCAPQEGWQCSYDZ

    Online Inquiry

    Note: There will be extra charge for optional service!

    Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

    Optional requirements on this protein    +Expand

    Price Inquiry

    Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.