"ALT" Related Products

Recombinant ALT protein, His-tagged

Cat.No.: ALT-116
Product Overview: Recombinant ALT was expressed in E. coli.
Source: E. coli
Tag: His
AA Sequence: MNKVLIIFGLVILLVTPLRAQEEDEMDDDEEFDGEDEGNDDSSSEGGDDGGDDSNDGGSNGGEDSEYVTKGKFVE TDGKKKQCNSHEACYDQREPQAWCILKKGQSWTNKGCFCEEKMNSCVIERKNGGNLEYAYCAPQEGWQCSYDZ
Products Types

◆ Assay kits

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.