Recombinant ALTm protein, His-tagged

Cat.No. : ALTm-117
Product Overview : Recombinant ALTm was expressed in E. coli.
Availability October 29, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
AA Sequence : MNKVLIIFGLVILLVTPLRAYVTKGKFVETDGKKKQCNSHEACYDQREPQAWCILKKGQSWTNKGCFCEEKMNSC VIERKNGGNLEYAYCAPQEGWQCSYDZ

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALTm Products

Required fields are marked with *

My Review for All ALTm Products

Required fields are marked with *

0
cart-icon
0
compare icon