Recombinant ALTm protein, His-tagged ALTm-117

Recombinant ALTm protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant ALTm protein, His-tagged

Recombinant ALTm protein, His-tagged

ALTm Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ALTm-117
Product Overview : Recombinant ALTm was expressed in E. coli.
Source : E. coli
Tag : His
AA Sequence : MNKVLIIFGLVILLVTPLRAYVTKGKFVETDGKKKQCNSHEACYDQREPQAWCILKKGQSWTNKGCFCEEKMNSC VIERKNGGNLEYAYCAPQEGWQCSYDZ

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy