Recombinant Human Growth Hormone Receptor, Fc Chimera
Cat.No. : | GHR-450H |
Product Overview : | Recombinant Human Growth Hormone Receptor encoding the signal peptide and extracellular domain of human growth hormone receptor (GH R; aa 1-254) was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 1-254 a.a. |
Description : | Human growth hormone receptor (GH R) is a type I membrane protein and is a member of the class I cytokine receptor family. GH R is highly expressed in the liver and in skeletal muscle as well as in the kidney, bladder, adrenal gland, brain, bone, cartilage, lung and stomach. Activation of GH R by GH regulates an extensive variety of physiological functions relating to human growth and metabolism. Specifically, binding of GH to GH R promotes the growth of bone, cartilage, and soft tissues, which occurs maximally during puberty. GH R activation also enhances the levels of hormones and neurotransmitters in the CNS, including IGF-1 and somatostatin. |
Amino Acid Sequence : | FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. |
Molecular Mass : | Growth Hormone Receptor-Fc Chimera migrates as a broad band between 65 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. |
pI : | Growth Hormone Receptor-Fc Chimera separates into a number of isoforms with a pI between 5.0 and 7.7 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified GH R-Fc Chimera that has a predicted pI of 6.90. |
% Carbohydrate : | Purified Growth Hormone Receptor-Fc Chimera consists of 15-35% carbohydrate by weight. |
Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Gene Name | GHR growth hormone receptor [ Homo sapiens ] |
Synonyms | GHR; growth hormone receptor; GHBP; serum binding protein; somatotropin receptor; growth hormone binding protein |
Gene ID | 2690 |
mRNA Refseq | NM_000163 |
Protein Refseq | NP_000154 |
UniProt ID | P10912 |
Chromosome Location | 5p14-p12 |
MIM | 600946 |
Pathway | Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Neuroactive ligand-receptor interaction |
Function | SH2 domain binding; growth hormone receptor activity; peptide hormone binding; phosphate binding; oline-rich region binding; otein kinase binding; receptor activity |
◆ Recombinant Proteins | ||
GHR-39H | Recombinant Human GHR protein | +Inquiry |
GHR-6744H | Recombinant Human GHR protein, His-tagged | +Inquiry |
GHR-362H | Recombinant Human GHR Protein, His-tagged | +Inquiry |
GHR-1506H | Active Recombinant Human GHR protein, Fc-tagged | +Inquiry |
GHR-1504R | Active Recombinant Rat GHR protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GHR-42H | Active Recombinant Human GHR Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *