"GHR" Related Products

Expand
Expand
Expand

Recombinant Human Growth Hormone Receptor, Fc Chimera

Cat. No.: GHR-450H
Product Overview: Recombinant Human Growth Hormone Receptor encoding the signal peptide and extracellular domain of human growth hormone receptor (GH R; aa 1-254) was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Human growth hormone receptor (GH R) is a type I membrane protein and is a member of the class I cytokine receptor family. GH R is highly expressed in the liver and in skeletal muscle as well as in the kidney, bladder, adrenal gland, brain, bone, cartilage, lung and stomach. Activation of GH R by GH regulates an extensive variety of physiological functions relating to human growth and metabolism. Specifically, binding of GH to GH R promotes the growth of bone, cartilage, and soft tissues, which occurs maximally during puberty. GH R activation also enhances the levels of hormones and neurotransmitters in the CNS, including IGF-1 and somatostatin.
Source: Human 293 cells.
Amino Acid Sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: Growth Hormone Receptor-Fc Chimera migrates as a broad band between 65 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation.
pI: Growth Hormone Receptor-Fc Chimera separates into a number of isoforms with a pI between 5.0 and 7.7 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified GH R-Fc Chimera that has a predicted pI of 6.90.
% Carbohydrate: Purified Growth Hormone Receptor-Fc Chimera consists of 15-35% carbohydrate by weight.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Gene Name: GHR growth hormone receptor [ Homo sapiens ]
Synonyms: GHR; growth hormone receptor; GHBP; serum binding protein; somatotropin receptor; growth hormone binding protein
Gene ID: 2690
mRNA Refseq: NM_000163
Protein Refseq: NP_000154
UniProt ID: P10912
Chromosome Location: 5p14-p12
MIM: 600946
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Neuroactive ligand-receptor interaction
Function: SH2 domain binding; growth hormone receptor activity; peptide hormone binding; phosphate binding; oline-rich region binding; otein kinase binding; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.