"GHR" Related Products

Expand
Expand
Expand

Recombinant Human Growth Hormone Receptor, Fc Chimera

Cat. No.: GHR-450H
Product Overview: Recombinant Human Growth Hormone Receptor encoding the signal peptide and extracellular domain of human growth hormone receptor (GH R; aa 1-254) was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.
Description: Human growth hormone receptor (GH R) is a type I membrane protein and is a member of the class I cytokine receptor family. GH R is highly expressed in the liver and in skeletal muscle as well as in the kidney, bladder, adrenal gland, brain, bone, cartilage, lung and stomach. Activation of GH R by GH regulates an extensive variety of physiological functions relating to human growth and metabolism. Specifically, binding of GH to GH R promotes the growth of bone, cartilage, and soft tissues, which occurs maximally during puberty. GH R activation also enhances the levels of hormones and neurotransmitters in the CNS, including IGF-1 and somatostatin.
Source: Human 293 cells.
Amino Acid Sequence: FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMRIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass: Growth Hormone Receptor-Fc Chimera migrates as a broad band between 65 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation.
pI: Growth Hormone Receptor-Fc Chimera separates into a number of isoforms with a pI between 5.0 and 7.7 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified GH R-Fc Chimera that has a predicted pI of 6.90.
% Carbohydrate: Purified Growth Hormone Receptor-Fc Chimera consists of 15-35% carbohydrate by weight.
Purity: >95%, as determined by SDS-PAGE and visualized by silver stain.
Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Gene Name: GHR growth hormone receptor [ Homo sapiens ]
Synonyms: GHR; growth hormone receptor; GHBP; serum binding protein; somatotropin receptor; growth hormone binding protein
Gene ID: 2690
mRNA Refseq: NM_000163
Protein Refseq: NP_000154
UniProt ID: P10912
Chromosome Location: 5p14-p12
MIM: 600946
Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Neuroactive ligand-receptor interaction
Function: SH2 domain binding; growth hormone receptor activity; peptide hormone binding; phosphate binding; oline-rich region binding; otein kinase binding; receptor activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.