"ACAA1" Related Products

Expand

Recombinant Human ACAA1, His-tagged

Cat.No.: ACAA1-26046TH
Product Overview: Recombinant full length Human ACAA1 with an N terminal His tag; 419 amino acids including tag, MWt 43.8kDa.
Description: This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
Protein length: 398 amino acids
Conjugation: HIS
Molecular Weight: 43.800kDa
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Sequence Similarities: Belongs to the thiolase family.
Gene Name: ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ]
Official Symbol: ACAA1
Synonyms: ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase;
Gene ID: 30
mRNA Refseq: NM_001130410
Protein Refseq: NP_001123882
MIM: 604054
Uniprot ID: P09110
Chromosome Location: 3p23-p22
Pathway: Beta-oxidation of very long chain fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem;
Function: acetyl-CoA C-acyltransferase activity; protein binding; transferase activity, transferring acyl groups other than amino-acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.