Recombinant Human ACAA1, His-tagged

Cat.No. : ACAA1-26046TH
Product Overview : Recombinant full length Human ACAA1 with an N terminal His tag; 419 amino acids including tag, MWt 43.8kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 398 amino acids
Description : This gene encodes an enzyme operative in the beta-oxidation system of the peroxisomes. Deficiency of this enzyme leads to pseudo-Zellweger syndrome. Alternative splicing results in multiple transcript variants.
Conjugation : HIS
Molecular Weight : 43.800kDa
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN
Sequence Similarities : Belongs to the thiolase family.
Gene Name ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ]
Official Symbol ACAA1
Synonyms ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase;
Gene ID 30
mRNA Refseq NM_001130410
Protein Refseq NP_001123882
MIM 604054
Uniprot ID P09110
Chromosome Location 3p23-p22
Pathway Beta-oxidation of very long chain fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, organism-specific biosystem; Biosynthesis of unsaturated fatty acids, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem;
Function acetyl-CoA C-acyltransferase activity; protein binding; transferase activity, transferring acyl groups other than amino-acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACAA1 Products

Required fields are marked with *

My Review for All ACAA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon