"AGAP1" Related Products

Expand
Expand

Recombinant Human AGAP1, His-tagged

Cat.No.: AGAP1-26447TH
Product Overview: Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa.
Description: This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed.
Form: Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII
Sequence Similarities: Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain.
Gene Name: AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
Official Symbol: AGAP1
Synonyms: AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099;
Gene ID: 116987
mRNA Refseq: NM_014914
Protein Refseq: NP_055729
MIM: 608651
Uniprot ID: Q9UPQ3
Chromosome Location: 2q37
Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function: ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.