"AGAP1" Related Products

Expand
Expand

Recombinant Human AGAP1, His-tagged

Cat.No.: AGAP1-26447TH
Product Overview: Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa.
Description: This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed.
Form: Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII
Sequence Similarities: Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain.
Gene Name: AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
Official Symbol: AGAP1
Synonyms: AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099;
Gene ID: 116987
mRNA Refseq: NM_014914
Protein Refseq: NP_055729
MIM: 608651
Uniprot ID: Q9UPQ3
Chromosome Location: 2q37
Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem;
Function: ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.