Recombinant Human AGAP1, His-tagged

• Cat.No.: AGAP1-26447TH
• Product Overview: Recombinant fragment, corresponding to amino acids 675-804 of Human AGAP1 with N terminal His tag; 130 amino acids, 18kDa.

Specification

• Description: This gene encodes a member of an ADP-ribosylation factor GTPase-activating protein family involved in membrane trafficking and cytoskeleton dynamics. This gene functions as a direct regulator of the adaptor-related protein complex 3 on endosomes. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Source: E. coli
• Tissue specificity: Widely expressed.
• Form: Lyophilised:Reconstitute with 148 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: TELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEG DGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTA LAYARQASSQECIDVLLQYGCPDERFVLMATPNLSRRN NNRNNSSGRVPTII
• Sequence Similarities: Belongs to the centaurin gamma-like family.Contains 2 ANK repeats.Contains 1 Arf-GAP domain.Contains 1 PH domain.

Gene Information

• Gene Name: AGAP1 ArfGAP with GTPase domain, ankyrin repeat and PH domain 1 [ Homo sapiens ]
• Official Symbol: AGAP1
• Synonyms: AGAP1; ArfGAP with GTPase domain, ankyrin repeat and PH domain 1; centaurin, gamma 2 , CENTG2; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1; GGAP1; KIAA1099
• Gene ID: 116987
• mRNA Refseq: NM_014914
• Protein Refseq: NP_055729
• MIM: 608651
• Uniprot ID: Q9UPQ3
• Chromosome Location: 2q37
• Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem
• Function: ARF GTPase activator activity; GTP binding; metal ion binding; nucleotide binding; zinc ion binding