Recombinant Human AKAP7

• Cat.No.: AKAP7-26524TH
• Product Overview: Recombinant full length Human AKAP7 produced in Saccharomyces cerevisiae; amino acids 1-81; 81 amino acids, 8.9kDa. Protein has a 26 kDa proprietary tag.

Specification

• Description: This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.
• Tissue specificity: Expressed in brain, heart, lung, pancreas and skeletal muscle.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENA VLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNEN NRK

Gene Information

• Gene Name: AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ]
• Official Symbol: AKAP7
• Synonyms: AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18
• Gene ID: 9465
• mRNA Refseq: NM_004842
• Protein Refseq: NP_004833
• MIM: 604693
• Uniprot ID: O43687
• Chromosome Location: 6q22-q24
• Pathway: G Protein Signaling Pathways, organism-specific biosystem
• Function: AMP binding; catalytic activity; protein C-terminus binding; protein complex scaffold; protein domain specific binding