"AKAP7" Related Products

Expand

Recombinant Human AKAP7

Cat.No. : AKAP7-26524TH
Product Overview : Recombinant full length Human AKAP7 produced in Saccharomyces cerevisiae; amino acids 1-81; 81 amino acids, 8.9kDa. Protein has a 26 kDa proprietary tag.
Description : This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described.
Tissue specificity : Expressed in brain, heart, lung, pancreas and skeletal muscle.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENA VLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNEN NRK
Gene Name : AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ]
Official Symbol : AKAP7
Synonyms : AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18;
Gene ID : 9465
mRNA Refseq : NM_004842
Protein Refseq : NP_004833
MIM : 604693
Uniprot ID : O43687
Chromosome Location : 6q22-q24
Pathway : G Protein Signaling Pathways, organism-specific biosystem;
Function : AMP binding; catalytic activity; protein C-terminus binding; protein complex scaffold; protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.