Recombinant Human AKAP7
Cat.No. : | AKAP7-26524TH |
Product Overview : | Recombinant full length Human AKAP7 produced in Saccharomyces cerevisiae; amino acids 1-81; 81 amino acids, 8.9kDa. Protein has a 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. |
Tissue specificity : | Expressed in brain, heart, lung, pancreas and skeletal muscle. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENA VLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNEN NRK |
Gene Name : | AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ] |
Official Symbol : | AKAP7 |
Synonyms : | AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18; |
Gene ID : | 9465 |
mRNA Refseq : | NM_004842 |
Protein Refseq : | NP_004833 |
MIM : | 604693 |
Uniprot ID : | O43687 |
Chromosome Location : | 6q22-q24 |
Pathway : | G Protein Signaling Pathways, organism-specific biosystem; |
Function : | AMP binding; catalytic activity; protein C-terminus binding; protein complex scaffold; protein domain specific binding; |
Products Types
◆ Recombinant Protein | ||
Akap7-1578M | Recombinant Mouse Akap7 Protein, Myc/DDK-tagged | +Inquiry |
AKAP7-249R | Recombinant Rat AKAP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKAP7-101H | Recombinant Human AKAP7 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Akap7-3031M | Recombinant Mouse Akap7, GST-tagged | +Inquiry |
AKAP7-402H | Recombinant Human AKAP7 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
AKAP7-8938HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
AKAP7-8937HCL | Recombinant Human AKAP7 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket