Recombinant Human APOF

PRODUCTS

Home / Products / Antibody / Recombinant Human APOF

Recombinant Human APOF

APOF Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : APOF-27294TH
Product Overview : Recombinant full length Human Apolipoprotein F with N terminal proprietary tag; Predicted MWt 58.01 kDa.
Description : The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol.
Protein length : 291 amino acids
Molecular Weight : 58.010kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed by the liver and secreted in plasma.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGF SHMAPLPKFLVSLALRNDALEEAGCQADVWALQLQLYRQG GVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLARE QQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNL GTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTK EGLRAISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSY DLDPGAGSLEI
Gene Name : APOF apolipoprotein F [ Homo sapiens ]
Official Symbol : APOF
Synonyms : APOF; apolipoprotein F;
Gene ID : 319
mRNA Refseq : NM_001638
Protein Refseq : NP_001629
Uniprot ID : Q13790
Chromosome Location : 12q13
Function : cholesterol binding; lipid transporter activity; receptor binding;

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.