"APOF" Related Products

Expand
Expand

Recombinant Human APOF

Cat.No.: APOF-27294TH
Product Overview: Recombinant full length Human Apolipoprotein F with N terminal proprietary tag; Predicted MWt 58.01 kDa.
Description: The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol.
Protein length: 291 amino acids
Molecular Weight: 58.010kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed by the liver and secreted in plasma.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGF SHMAPLPKFLVSLALRNDALEEAGCQADVWALQLQLYRQG GVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLARE QQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNL GTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTK EGLRAISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSY DLDPGAGSLEI
Gene Name: APOF apolipoprotein F [ Homo sapiens ]
Official Symbol: APOF
Synonyms: APOF; apolipoprotein F;
Gene ID: 319
mRNA Refseq: NM_001638
Protein Refseq: NP_001629
Uniprot ID: Q13790
Chromosome Location: 12q13
Function: cholesterol binding; lipid transporter activity; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.