Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human APOF

Cat.No. : APOF-27294TH
Product Overview : Recombinant full length Human Apolipoprotein F with N terminal proprietary tag; Predicted MWt 58.01 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol.
Protein length : 291 amino acids
Molecular Weight : 58.010kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed by the liver and secreted in plasma.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGF SHMAPLPKFLVSLALRNDALEEAGCQADVWALQLQLYRQG GVNATQVLIQHLRGLQKGRSTERNVSVEALASALQLLARE QQSTGRVGRSLPTEDCENEKEQAVHNVVQLLPGVGTFYNL GTALYYATQNCLGKARERGRDGAIDLGYDLLMTMAGMSGG PMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTK EGLRAISDVSDLEETTTLASFISEVVSSAPYWGWAIIKSY DLDPGAGSLEI
Gene Name : APOF apolipoprotein F [ Homo sapiens ]
Official Symbol : APOF
Synonyms : APOF; apolipoprotein F;
Gene ID : 319
mRNA Refseq : NM_001638
Protein Refseq : NP_001629
Uniprot ID : Q13790
Chromosome Location : 12q13
Function : cholesterol binding; lipid transporter activity; receptor binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (20)

Ask a question
Can APOF protein levels be measured in the blood? 02/15/2023

Yes, APOF protein levels can be measured in the blood using various laboratory techniques such as enzyme-linked immunosorbent assay (ELISA) or mass spectrometry. These tests provide information about the concentration of APOF protein in circulation.

How is the APOF protein studied in research? 12/18/2021

Researchers study the APOF protein using various techniques, including protein isolation and purification, genetic analysis, animal models, and cell culture experiments. These approaches help in understanding the protein's structure, function, and how it is involved in lipid metabolism.

Are there any known interactions of APOF protein with other proteins? 05/04/2021

Yes, APOF protein is known to interact with several other proteins involved in lipid metabolism. For example, it binds to lipoprotein receptors, lipases, and lipid transfer proteins, facilitating the transport and metabolism of lipids.

Are there any genetic variations in the APOF gene that affect protein function? 05/02/2021

Yes, certain genetic variations in the APOF gene have been identified that affect protein function and may impact lipid metabolism. These variations are being studied for their potential association with cardiovascular diseases.

What are the potential roles of APOF protein in lipid metabolism? 02/26/2021

Apart from its role in lipoprotein lipase activation, APOF protein is thought to be involved in the regulation of fatty acid and triglyceride metabolism, as well as cholesterol efflux and reverse cholesterol transport.

Are there any drugs or interventions that target the APOF protein? 02/08/2021

Currently, there are no specific drugs or interventions that directly target the APOF protein. However, the modulation of APOF function and lipid metabolism is often targeted through other approaches, such as statin medications for managing dyslipidemia.

How is the APOF protein related to cardiovascular health? 06/24/2019

APOF protein is involved in the regulation of lipid metabolism, including cholesterol transport. Altered levels or functionality of APOF may contribute to dyslipidemia, a known risk factor for cardiovascular diseases such as atherosclerosis and coronary heart disease.

Can APOF protein be used as a biomarker for certain diseases? 02/20/2018

Currently, there is limited evidence to suggest that APOF protein can be used as a specific biomarker for any particular disease or disorder. However, ongoing research is exploring its potential as a biomarker for dyslipidemia and cardiovascular risk.

How does diet affect the expression or function of the APOF protein? 01/07/2018

Diet plays a crucial role in lipid metabolism, and certain dietary components, such as fats and cholesterol, can influence the expression and function of APOF protein. High-fat diets, for instance, can alter APOF gene expression and affect lipid metabolism.

What are the potential therapeutic implications of targeting APOF protein? 09/11/2017

Targeting the APOF protein has potential therapeutic implications for conditions involving dyslipidemia and cardiovascular diseases. By modulating APOF function, it may be possible to regulate lipid metabolism and promote healthy lipid profiles.

Is the APOF protein exclusively produced in the liver? 08/18/2017

The liver is the primary site of APOF protein synthesis. However, other tissues, such as the small intestine and adipose tissue, also produce lower amounts of APOF. The liver remains the major contributor to circulating APOF levels.

Are there any known disorders associated with APOF protein? 08/02/2017

Currently, no specific disorders or diseases have been directly linked to APOF protein mutations or deficiencies. However, further research may uncover potential associations with specific conditions related to lipid metabolism and cardiovascular health.

Does APOF protein have any role in neurological functions or disorders? 06/03/2017

While the primary function of APOF protein lies in lipid metabolism, there is emerging evidence suggesting its potential involvement in neuroinflammatory processes and neurodegenerative disorders, such as Alzheimer's disease. However, more research is needed to elucidate these relationships.

Can APOF protein be used as a target for therapeutic interventions? 04/25/2017

Targeting the APOF protein directly for therapeutic interventions is still being studied. However, its involvement in lipid metabolism and potential association with cardiovascular diseases make it an attractive target for future therapeutic strategies.

Does APOF protein play a role in immune response or inflammation? 12/15/2016

While the exact role of APOF protein in immune response and inflammation is not fully understood, there is evidence suggesting its involvement in modulating inflammatory processes. It may play a role in regulating cytokine production and immune cell function.

How is the APOF protein linked to cholesterol levels? 10/03/2016

APOF protein is part of high-density lipoprotein (HDL), commonly referred to as the "good" cholesterol. HDL helps remove excess cholesterol from the bloodstream and transports it back to the liver for disposal.

Are there any genetic mutations or variations associated with the APOF gene? 08/17/2016

Yes, genetic mutations and variations in the APOF gene have been identified. For example, certain single nucleotide polymorphisms (SNPs) in the APOF gene have been associated with altered lipid profiles and increased risk of cardiovascular diseases.

How is the APOF protein synthesized in the body? 07/21/2016

The APOF protein is synthesized in the liver, where it is produced as a precursor protein called pre-apo F. This precursor undergoes post-translational modifications, including cleavage and lipidation, to form the mature APOF protein.

Are there any known APOF protein deficiencies or dysfunctions? 06/04/2016

As of now, there haven't been any specific APOF protein deficiencies or dysfunctions identified. However, further research may uncover potential associations between APOF dysfunction and certain diseases or conditions.

Can the APOF protein be targeted for therapeutic interventions? 01/08/2016

While research is ongoing, the APOF protein has shown potential as a therapeutic target for managing dyslipidemia and related cardiovascular diseases. Developing drugs that modulate APOF function could potentially help regulate lipid metabolism and mitigate the risk of cardiovascular complications.

Customer Reviews (4)

Write a review
Reviews
06/16/2021

    The technical support provided by the manufacturer is invaluable in resolving any potential roadblocks and optimizing the utilization of APOF protein.

    06/30/2019

      With their assistance, I am confident in overcoming challenges, producing robust results, and advancing our understanding of APOF protein and its biological significance.

      10/26/2016

        In addition to the impeccable protein quality, the manufacturer provides excellent technical support that can effectively address any challenges I may encounter during my experiments.

        04/11/2016

          This reliable supply chain management assures that I have uninterrupted access to the protein, allowing me to plan and conduct my experiments without concern for availability issues.

          Ask a Question for All APOF Products

          Required fields are marked with *

          My Review for All APOF Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends