"ARG1" Related Products

Expand
Expand

Recombinant Human ARG1, His-tagged

Cat.No.: ARG1-28658TH
Product Overview: Recombinant full length Human liver Arginase with His tag at the C terminus; 330 aa, 35.8 kDa.
Description: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 322 amino acids
Conjugation: HIS
Molecular Weight: 35.800kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 0.58% Sodium phosphate, 20% Glycerol
Storage: Please see Notes section
Sequences of amino acids: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKL KEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM TEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP PKLEHHHHHH
Sequence Similarities: Belongs to the arginase family.
Gene Name: ARG1 arginase, liver [ Homo sapiens ]
Official Symbol: ARG1
Synonyms: ARG1; arginase, liver; arginase-1;
Gene ID: 383
mRNA Refseq: NM_000045
Protein Refseq: NP_000036
MIM: 608313
Uniprot ID: P05089
Chromosome Location: 6q23
Pathway: ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem;
Function: arginase activity; hydrolase activity; manganese ion binding; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.