Recombinant Human ARG1, His-tagged
Cat.No. : | ARG1-28658TH |
Product Overview : | Recombinant full length Human liver Arginase with His tag at the C terminus; 330 aa, 35.8 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 322 amino acids |
Conjugation : | HIS |
Molecular Weight : | 35.800kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 0.58% Sodium phosphate, 20% Glycerol |
Storage : | Please see Notes section |
Sequences of amino acids : | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKL KEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGV IWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSM TEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNP SLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP PKLEHHHHHH |
Sequence Similarities : | Belongs to the arginase family. |
Gene Name : | ARG1 arginase, liver [ Homo sapiens ] |
Official Symbol : | ARG1 |
Synonyms : | ARG1; arginase, liver; arginase-1; |
Gene ID : | 383 |
mRNA Refseq : | NM_000045 |
Protein Refseq : | NP_000036 |
MIM : | 608313 |
Uniprot ID : | P05089 |
Chromosome Location : | 6q23 |
Pathway : | ATF-2 transcription factor network, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; |
Function : | arginase activity; hydrolase activity; manganese ion binding; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
ARG1-296H | Recombinant Human ARG1 Protein, His/MYC-tagged | +Inquiry |
Arg1-1132M | Recombinant Mouse Arg1 Protein, His-tagged | +Inquiry |
ARG1-012H | Recombinant Human ARG1 Protein, His-tagged | +Inquiry |
ARG1-2582H | Recombinant Human ARG1 Protein, MYC/DDK-tagged | +Inquiry |
ARG1-812H | Recombinant Human ARG1 Protein | +Inquiry |
◆ Native Protein | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket