Recombinant Mouse Arg1 Protein, His-tagged

• Cat.No.: Arg1-1132M
• Product Overview: Recombinant Mouse Arg1 (1-323aa) Protein was expressed in yeast with N-terminal His-tag.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 1-323 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 36.8 kDa
• AA Sequence: MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: Arg1 arginase, liver [ Mus musculus (house mouse) ]
• Official Symbol: Arg1
• Synonyms: AI; PGIF; Arg-1; AI256583; arginase 1, liver; arginase I; liver-type arginase; type I arginase; arginase-1
• Gene ID: 11846
• mRNA Refseq: NM_007482.3
• Protein Refseq: NP_031508.1
• UniProt ID: Q61176