Recombinant Mouse Arg1 Protein, His-tagged

Cat.No. : Arg1-1132M
Product Overview : Recombinant Mouse Arg1 (1-323aa) Protein was expressed in yeast with N-terminal His-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 1-323 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 36.8 kDa
AA Sequence : MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Arg1 arginase, liver [ Mus musculus (house mouse) ]
Official Symbol Arg1
Synonyms AI; PGIF; Arg-1; AI256583; arginase 1, liver; arginase I; liver-type arginase; type I arginase; arginase-1
Gene ID 11846
mRNA Refseq NM_007482.3
Protein Refseq NP_031508.1
UniProt ID Q61176

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Arg1 Products

Required fields are marked with *

My Review for All Arg1 Products

Required fields are marked with *

0
cart-icon
0
compare icon