Recombinant Full Length Vigna Radiata Var. Radiata Omega-3 Fatty Acid Desaturase, Endoplasmic Reticulum(Arg1) Protein, His-Tagged
Cat.No. : | RFL33672VF |
Product Overview : | Recombinant Full Length Vigna radiata var. radiata Omega-3 fatty acid desaturase, endoplasmic reticulum(ARG1) Protein (P32291) (1-380aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vigna radiata var. radiata (Mung bean) (Phaseolus aureus) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-380) |
Form : | Lyophilized powder |
AA Sequence : | MIQAQTLQHFGNGAREGDQSYFDPGAPPPFKIADIRAAIPKHCWEKSTLRSLSYVLRDVL VVTALAASAISFNSWFFWPLYWPAQGTMFWALFVLGHDCGHGSFSNSSKLNSFVGHILHS LILVPYNGWRISHRTHHQNHGHVEKDESWVPLTEKVYKNLDDMTRMLRYSFPFPIFAYPF YLWNRSPGKEGSHFNPYSNLFSPGERKGVVTSTLCWGIVLSVLLYLSLTIGPIFMLKLYG VPYLIFVMWLDFVTYLHHHGYTHKLPWYRGQEWSYLRGGLTTVDRDYGWINNVHHDIGTH VIHHLFPQIPHYHLVEATKSAKSVLGKYYREPQKSGPLPFHLLKYLLQSISQDHFVSDTG DIVYYQTDPKLHQDSWTKSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ARG1 |
Synonyms | ARG1; Omega-3 fatty acid desaturase, endoplasmic reticulum; Indole-3-acetic acid-induced protein ARG1 |
UniProt ID | P32291 |
◆ Recombinant Proteins | ||
ARG1-2582H | Recombinant Human ARG1 Protein, MYC/DDK-tagged | +Inquiry |
ARG1-0628H | Recombinant Human ARG1 Protein (Met1-lys322), C-His-tagged | +Inquiry |
Arg1-4538M | Recombinant Mouse Arg1 protein, His-SUMO-tagged | +Inquiry |
ARG1-2961H | Recombinant Human ARG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARG1-9810H | Recombinant Human ARG1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARG1 Products
Required fields are marked with *
My Review for All ARG1 Products
Required fields are marked with *