Recombinant Human BRSK1, His-tagged
Cat.No. : | BRSK1-27740TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 591-778 of Human BRSK1, with N terminal His tag, 188aa, 23kDa, |
- Specification
- Gene Information
- Related Products
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed, with highest levels in brain and testis. Protein levels remain constant throughout the cell cycle. |
Form : | Lyophilised:reconstitution with 149 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLS IPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSS EGPEPSPRRDGSGGGGIYSVTFTLISGPSRRFKRVVETIQ AQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGR PDPELSSSPRRGPPKDKKLLATNGTPLP |
Sequence Similarities : | Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. AMPK subfamily.Contains 1 protein kinase domain.Contains 1 UBA domain. |
Gene Name : | BRSK1 BR serine/threonine kinase 1 [ Homo sapiens ] |
Official Symbol : | BRSK1 |
Synonyms : | BRSK1; BR serine/threonine kinase 1; serine/threonine-protein kinase BRSK1; KIAA1811; |
Gene ID : | 84446 |
mRNA Refseq : | NM_032430 |
Protein Refseq : | NP_115806 |
MIM : | 609235 |
Uniprot ID : | Q8TDC3 |
Chromosome Location : | 19q13.4 |
Pathway : | LKB1 signaling events, organism-specific biosystem; |
Function : | ATP binding; gamma-tubulin binding; magnesium ion binding; nucleotide binding; protein serine/threonine kinase activity; |
Products Types
◆ Recombinant Protein | ||
BRSK1-1174H | Recombinant Human BRSK1 Protein (S2-P778), Tag Free | +Inquiry |
BRSK1-1175H | Recombinant Human BRSK1 Protein (S2-P778), GST tagged | +Inquiry |
BRSK1-5370H | Recombinant Human BR Serine/Threonine Kinase 1, GST-tagged | +Inquiry |
BRSK1-678R | Recombinant Rat BRSK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BRSK1-1020R | Recombinant Rat BRSK1 Protein | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket