"CCNG1" Related Products

Expand
Expand
Expand

Recombinant Human CCNG1, His-tagged

Cat.No.: CCNG1-26094TH
Product Overview: Recombinant full length Human Cyclin G with an N-terminal His tag. 315 amino acides with a predicted MWt34 kDa including the tag
Description: The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene.
Protein length: 295 amino acids
Conjugation: HIS
Molecular Weight: 36.200kDa inclusive of tags
Source: E. coli
Tissue specificity: High levels in skeletal muscle, ovary, kidney and colon.
Form: Liquid
Purity: by SDS-PAGE
Storage buffer: pH: 8.00Constituents:1.17% Sodium chloride, 0.08% DTT, 50% Glycerol, 0.32% Tris HCl
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNAL LEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLS CFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVEL TEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKP NVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
Sequence Similarities: Belongs to the cyclin family. Cyclin G subfamily.
Gene Name: CCNG1 cyclin G1 [ Homo sapiens ]
Official Symbol: CCNG1
Synonyms: CCNG1; cyclin G1; CCNG; cyclin-G1;
Gene ID: 900
mRNA Refseq: NM_004060
Protein Refseq: NP_004051
MIM: 601578
Uniprot ID: P51959
Chromosome Location: 5q32-q34
Pathway: Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem;
Function: protein domain specific binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.