Recombinant Human CCNG1, His-tagged
Cat.No. : | CCNG1-26094TH |
Product Overview : | Recombinant full length Human Cyclin G with an N-terminal His tag. 315 amino acides with a predicted MWt34 kDa including the tag |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 295 amino acids |
Description : | The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene. |
Conjugation : | HIS |
Molecular Weight : | 36.200kDa inclusive of tags |
Tissue specificity : | High levels in skeletal muscle, ovary, kidney and colon. |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:1.17% Sodium chloride, 0.08% DTT, 50% Glycerol, 0.32% Tris HCl |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNAL LEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLS CFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVEL TEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKP NVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP |
Sequence Similarities : | Belongs to the cyclin family. Cyclin G subfamily. |
Gene Name | CCNG1 cyclin G1 [ Homo sapiens ] |
Official Symbol | CCNG1 |
Synonyms | CCNG1; cyclin G1; CCNG; cyclin-G1; |
Gene ID | 900 |
mRNA Refseq | NM_004060 |
Protein Refseq | NP_004051 |
MIM | 601578 |
Uniprot ID | P51959 |
Chromosome Location | 5q32-q34 |
Pathway | Direct p53 effectors, organism-specific biosystem; p53 pathway, organism-specific biosystem; p53 signaling pathway, organism-specific biosystem; p53 signaling pathway, conserved biosystem; |
Function | protein domain specific binding; |
◆ Recombinant Proteins | ||
CCNG1-2974HF | Recombinant Full Length Human CCNG1 Protein, GST-tagged | +Inquiry |
CCNG1-26094TH | Recombinant Human CCNG1, His-tagged | +Inquiry |
CCNG1-3613H | Recombinant Human CCNG1 protein, GST-tagged | +Inquiry |
CCNG1-9922Z | Recombinant Zebrafish CCNG1 | +Inquiry |
CCNG1-0669H | Recombinant Human CCNG1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNG1-7707HCL | Recombinant Human CCNG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNG1 Products
Required fields are marked with *
My Review for All CCNG1 Products
Required fields are marked with *