Recombinant Human CHRNE

Cat.No. : CHRNE-29131TH
Product Overview : Recombinant fragment Human Nicotinic Acetylcholine Receptor epsilon with N-terminal proprietary tag.Mol Wt 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome.
Molecular Weight : 37.730kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNL ISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRV PSELVWLPEIVLENNIDGQFGVAYDANVLV
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Epsilon/CHRNE sub-subfamily.
Gene Name CHRNE cholinergic receptor, nicotinic, epsilon [ Homo sapiens ]
Official Symbol CHRNE
Synonyms CHRNE; cholinergic receptor, nicotinic, epsilon; cholinergic receptor, nicotinic, epsilon polypeptide; acetylcholine receptor subunit epsilon; ACHRE;
Gene ID 1145
mRNA Refseq NM_000080
Protein Refseq NP_000071
MIM 100725
Uniprot ID Q04844
Chromosome Location 17p13.2
Pathway Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly sodium permeable acetylcholine nicotinic receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; cation transmembrane transporter activity; extracellular ligand-gated ion channel activity; ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNE Products

Required fields are marked with *

My Review for All CHRNE Products

Required fields are marked with *

0

Inquiry Basket

cartIcon