Recombinant Human DVL3

Cat.No. : DVL3-28354TH
Product Overview : Recombinant fragment of Human Dishevelled 3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP*
Sequence Similarities : Belongs to the DSH family.Contains 1 DEP domain.Contains 1 DIX domain.Contains 1 PDZ (DHR) domain.
Gene Name DVL3 dishevelled, dsh homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol DVL3
Synonyms DVL3; dishevelled, dsh homolog 3 (Drosophila); dishevelled 3 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-3; KIAA0208;
Gene ID 1857
mRNA Refseq NM_004423
Protein Refseq NP_004414
MIM 601368
Uniprot ID Q92997
Chromosome Location 3q27
Pathway Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; HTLV-I infection, organism-specific biosystem;
Function beta-catenin binding; frizzled binding; protease binding; protein binding; protein heterodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DVL3 Products

Required fields are marked with *

My Review for All DVL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon