"ENOX1" Related Products

Expand

Recombinant Human ENOX1, His-tagged

Cat.No.: ENOX1-28568TH
Product Overview: Recombinant fragment, corresponding to amino acids 269-643 of Human ENOX1 with an N terminal His tag; Predicted MWt 45 kDa;
Description: Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes (Scarlett et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LAEKLKDDSKFSEAITVLLSWIERGEVNRRSANQFYSMVQ SANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQF EQIVAVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELR NAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDESAL AAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEE NLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQ AKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNE INVLTVALVNQDRENNIEKRSQGLKSEKEALLIGIIST FLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLP RMFKQEFTGVGATLEKRWKLCAFEGIKTT
Gene Name: ENOX1 ecto-NOX disulfide-thiol exchanger 1 [ Homo sapiens ]
Official Symbol: ENOX1
Synonyms: ENOX1; ecto-NOX disulfide-thiol exchanger 1; cCNOX; CNOX; FLJ10094; PIG38;
Gene ID: 55068
mRNA Refseq: NM_017993
Protein Refseq: NP_060463
MIM: 610914
Uniprot ID: Q8TC92
Chromosome Location: 13q14.11
Function: nucleic acid binding; nucleotide binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.