"EPS8L2" Related Products

Expand
Expand

Recombinant Human EPS8L2, His-tagged

Cat.No.: EPS8L2-28683TH
Product Overview: Recombinant fragment, corresponding to amino acids 559-731 of Human EPS8L2 with a N terminal His tag; 32kDa,
Description: This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 103 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: CNILGEARPEDAGAPFEQAGQKYWGPASPTHKLPPSFPGN KDELMQHMDEVNDELIRKISNIRAQPQRHFRVERSQPV SQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQL FSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELE ELMNKFHSMNQRRGEDS
Gene Name: EPS8L2 EPS8-like 2 [ Homo sapiens ]
Official Symbol: EPS8L2
Synonyms: EPS8L2; EPS8-like 2; epidermal growth factor receptor kinase substrate 8-like protein 2; FLJ21935; FLJ22171; MGC3088;
Gene ID: 64787
mRNA Refseq: NM_022772
Protein Refseq: NP_073609
Uniprot ID: Q9H6S3
Chromosome Location: 11p15.5

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.