Recombinant Human EPS8L2, His-tagged
Cat.No. : | EPS8L2-28683TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 559-731 of Human EPS8L2 with a N terminal His tag; 32kDa, |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the EPS8 gene family. The encoded protein, like other members of the family, is thought to link growth factor stimulation to actin organization, generating functional redundancy in the pathways that regulate actin cytoskeletal remodeling. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 103 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CNILGEARPEDAGAPFEQAGQKYWGPASPTHKLPPSFPGN KDELMQHMDEVNDELIRKISNIRAQPQRHFRVERSQPV SQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQL FSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELE ELMNKFHSMNQRRGEDS |
Gene Name : | EPS8L2 EPS8-like 2 [ Homo sapiens ] |
Official Symbol : | EPS8L2 |
Synonyms : | EPS8L2; EPS8-like 2; epidermal growth factor receptor kinase substrate 8-like protein 2; FLJ21935; FLJ22171; MGC3088; |
Gene ID : | 64787 |
mRNA Refseq : | NM_022772 |
Protein Refseq : | NP_073609 |
Uniprot ID : | Q9H6S3 |
Chromosome Location : | 11p15.5 |
Products Types
◆ Recombinant Protein | ||
EPS8L2-2830M | Recombinant Mouse EPS8L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EPS8L2-3429H | Recombinant Human EPS8L2 Protein, GST-tagged | +Inquiry |
EPS8L2-2122H | Recombinant Human EPS8L2 Protein, MYC/DDK-tagged | +Inquiry |
Eps8l2-2848M | Recombinant Mouse Eps8l2 Protein, Myc/DDK-tagged | +Inquiry |
EPS8L2-12507H | Recombinant Human EPS8L2, His-tagged | +Inquiry |
◆ Lysates | ||
EPS8L2-571HCL | Recombinant Human EPS8L2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket